Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K534

Protein Details
Accession E3K534   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-70PIAIVKAPAKRKKRNTPNKPNKPNKPNKPSEPSHydrophilic
NLS Segment(s)
PositionSequence
29-66GFRKRAYRDPIAIVKAPAKRKKRNTPNKPNKPNKPNKP
Subcellular Location(s) extr 7, E.R. 5, golg 4, mito 3, plas 2, pero 2, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
KEGG pgr:PGTG_05670  -  
Amino Acid Sequences MRLLLIVAALIPFAYLLEPERQLQPDGKGFRKRAYRDPIAIVKAPAKRKKRNTPNKPNKPNKPNKPSEPSEPSETNTSSIDLGPGFLQRPHKDDTIYALYSGADGYYTEMFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.06
4 0.1
5 0.12
6 0.14
7 0.17
8 0.19
9 0.2
10 0.22
11 0.24
12 0.28
13 0.32
14 0.38
15 0.43
16 0.43
17 0.48
18 0.54
19 0.55
20 0.57
21 0.6
22 0.58
23 0.53
24 0.56
25 0.55
26 0.49
27 0.46
28 0.38
29 0.34
30 0.34
31 0.4
32 0.42
33 0.46
34 0.52
35 0.61
36 0.7
37 0.76
38 0.82
39 0.85
40 0.88
41 0.91
42 0.93
43 0.94
44 0.93
45 0.92
46 0.91
47 0.91
48 0.9
49 0.88
50 0.85
51 0.81
52 0.79
53 0.73
54 0.7
55 0.66
56 0.59
57 0.56
58 0.49
59 0.44
60 0.4
61 0.36
62 0.3
63 0.24
64 0.21
65 0.16
66 0.14
67 0.13
68 0.09
69 0.09
70 0.08
71 0.09
72 0.09
73 0.12
74 0.2
75 0.21
76 0.25
77 0.28
78 0.29
79 0.29
80 0.29
81 0.32
82 0.31
83 0.3
84 0.27
85 0.23
86 0.21
87 0.2
88 0.19
89 0.12
90 0.06
91 0.05
92 0.08