Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JYU8

Protein Details
Accession E3JYU8   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
236-264HVATPPVTKVKRKKKKDRNRSRNSSQASSHydrophilic
NLS Segment(s)
PositionSequence
173-183NMKRRGRPPKK
244-257KVKRKKKKDRNRSR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0071819  C:DUBm complex  
GO:0000124  C:SAGA complex  
GO:0046872  F:metal ion binding  
GO:0003713  F:transcription coactivator activity  
GO:0016578  P:histone deubiquitination  
GO:0045893  P:positive regulation of DNA-templated transcription  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG pgr:PGTG_03179  -  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MNNIHNSPHNQQLLPSDQSSSTGETRPYFNQRAPPDVGNQAPISQDDGIGMLVDSVFNGLLEEMIWKICVLEFKRAKKFHLFSAEQELYANEKKNGNEKSNPDPVHDCPVCGREVSAARFAPHLSKCLGIGGRGQAAKKGIRSDFSESESVAKGSSHTSLDFAAVSRNRTGGNMKRRGRPPKKLPAVPLSPAEHEVLLSNAINNATQRLHLQGIGMAGTSSHKPAPSVPHPLSQSHVATPPVTKVKRKKKKDRNRSRNSSQASSSSDSEEEDGADGEEDGDEQEGDDGEDDHQPFTPGGRIDDENDTGGQQRGISENPSISSTSVAPVAPATTAVLPRPVLKRRSSSQADSTDGSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.32
4 0.28
5 0.3
6 0.3
7 0.28
8 0.25
9 0.24
10 0.27
11 0.26
12 0.3
13 0.34
14 0.41
15 0.42
16 0.43
17 0.48
18 0.48
19 0.52
20 0.53
21 0.48
22 0.44
23 0.45
24 0.42
25 0.37
26 0.34
27 0.29
28 0.25
29 0.23
30 0.22
31 0.17
32 0.15
33 0.12
34 0.12
35 0.1
36 0.09
37 0.08
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.14
57 0.15
58 0.25
59 0.32
60 0.41
61 0.5
62 0.52
63 0.56
64 0.59
65 0.59
66 0.56
67 0.58
68 0.52
69 0.45
70 0.53
71 0.5
72 0.4
73 0.38
74 0.31
75 0.26
76 0.28
77 0.27
78 0.2
79 0.23
80 0.24
81 0.32
82 0.37
83 0.38
84 0.41
85 0.43
86 0.48
87 0.53
88 0.53
89 0.48
90 0.46
91 0.42
92 0.45
93 0.4
94 0.34
95 0.27
96 0.28
97 0.25
98 0.21
99 0.19
100 0.14
101 0.18
102 0.2
103 0.22
104 0.21
105 0.21
106 0.22
107 0.22
108 0.24
109 0.21
110 0.21
111 0.17
112 0.16
113 0.16
114 0.19
115 0.19
116 0.13
117 0.14
118 0.14
119 0.17
120 0.18
121 0.18
122 0.16
123 0.18
124 0.2
125 0.2
126 0.23
127 0.2
128 0.21
129 0.25
130 0.29
131 0.28
132 0.3
133 0.28
134 0.24
135 0.24
136 0.22
137 0.19
138 0.13
139 0.11
140 0.08
141 0.09
142 0.1
143 0.09
144 0.08
145 0.09
146 0.09
147 0.1
148 0.09
149 0.08
150 0.11
151 0.12
152 0.13
153 0.13
154 0.13
155 0.13
156 0.14
157 0.19
158 0.22
159 0.3
160 0.39
161 0.43
162 0.49
163 0.57
164 0.67
165 0.7
166 0.73
167 0.72
168 0.73
169 0.77
170 0.73
171 0.69
172 0.65
173 0.6
174 0.52
175 0.47
176 0.38
177 0.31
178 0.29
179 0.25
180 0.17
181 0.14
182 0.12
183 0.09
184 0.08
185 0.07
186 0.05
187 0.06
188 0.06
189 0.06
190 0.06
191 0.08
192 0.07
193 0.08
194 0.08
195 0.1
196 0.1
197 0.1
198 0.1
199 0.09
200 0.09
201 0.09
202 0.08
203 0.06
204 0.05
205 0.06
206 0.07
207 0.07
208 0.08
209 0.08
210 0.09
211 0.11
212 0.19
213 0.22
214 0.3
215 0.3
216 0.35
217 0.37
218 0.37
219 0.37
220 0.34
221 0.31
222 0.24
223 0.25
224 0.2
225 0.19
226 0.19
227 0.21
228 0.26
229 0.28
230 0.34
231 0.41
232 0.52
233 0.62
234 0.72
235 0.79
236 0.81
237 0.9
238 0.93
239 0.95
240 0.95
241 0.96
242 0.94
243 0.91
244 0.89
245 0.83
246 0.76
247 0.67
248 0.6
249 0.54
250 0.48
251 0.41
252 0.34
253 0.28
254 0.24
255 0.23
256 0.18
257 0.14
258 0.1
259 0.09
260 0.07
261 0.07
262 0.06
263 0.05
264 0.05
265 0.05
266 0.05
267 0.05
268 0.04
269 0.04
270 0.05
271 0.05
272 0.05
273 0.05
274 0.06
275 0.07
276 0.11
277 0.12
278 0.12
279 0.12
280 0.13
281 0.13
282 0.14
283 0.17
284 0.14
285 0.15
286 0.19
287 0.2
288 0.22
289 0.26
290 0.26
291 0.23
292 0.22
293 0.21
294 0.19
295 0.19
296 0.16
297 0.12
298 0.12
299 0.13
300 0.15
301 0.16
302 0.17
303 0.17
304 0.18
305 0.19
306 0.19
307 0.17
308 0.17
309 0.15
310 0.15
311 0.15
312 0.13
313 0.12
314 0.12
315 0.12
316 0.1
317 0.1
318 0.1
319 0.11
320 0.13
321 0.13
322 0.16
323 0.17
324 0.22
325 0.3
326 0.36
327 0.4
328 0.45
329 0.51
330 0.53
331 0.62
332 0.64
333 0.63
334 0.64
335 0.63
336 0.61
337 0.55
338 0.51