Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2GZF7

Protein Details
Accession Q2GZF7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-45EPNPPNPPTDHRPPKKTRPLAASHydrophilic
167-197EREVKERGERRERKEKEKREKENRRPLIEDRBasic
NLS Segment(s)
PositionSequence
150-191PKVEKAERKARMREWEREREVKERGERRERKEKEKREKENRR
Subcellular Location(s) cyto 8, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
Amino Acid Sequences MSSASPPFDFPRLFPTGHTDEREPNPPNPPTDHRPPKKTRPLAASPQPADFYWQYKCAICHAPIAQADGADFIGHAPCLHRGTCPRSSCIRAYYGGSRQWALPYERGSSSSKPLFCQAAGCGGRIEAWCYVKAVASPRRGRVVALPQGDPKVEKAERKARMREWEREREVKERGERRERKEKEKREKENRRPLIEDRVDFFLGTALLCGAVCCCSPLICFRGVLDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.34
4 0.38
5 0.41
6 0.37
7 0.41
8 0.45
9 0.52
10 0.48
11 0.45
12 0.48
13 0.47
14 0.47
15 0.47
16 0.5
17 0.49
18 0.56
19 0.63
20 0.64
21 0.71
22 0.76
23 0.81
24 0.84
25 0.85
26 0.81
27 0.78
28 0.77
29 0.77
30 0.77
31 0.76
32 0.66
33 0.6
34 0.55
35 0.46
36 0.44
37 0.35
38 0.29
39 0.23
40 0.23
41 0.23
42 0.23
43 0.24
44 0.23
45 0.26
46 0.24
47 0.26
48 0.25
49 0.28
50 0.26
51 0.28
52 0.23
53 0.19
54 0.18
55 0.13
56 0.12
57 0.07
58 0.07
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.08
65 0.1
66 0.11
67 0.13
68 0.18
69 0.24
70 0.32
71 0.33
72 0.33
73 0.36
74 0.4
75 0.4
76 0.37
77 0.33
78 0.27
79 0.28
80 0.28
81 0.28
82 0.27
83 0.26
84 0.24
85 0.22
86 0.22
87 0.22
88 0.19
89 0.18
90 0.17
91 0.19
92 0.18
93 0.21
94 0.22
95 0.21
96 0.23
97 0.25
98 0.23
99 0.22
100 0.23
101 0.21
102 0.18
103 0.18
104 0.13
105 0.18
106 0.17
107 0.17
108 0.15
109 0.14
110 0.15
111 0.14
112 0.16
113 0.1
114 0.11
115 0.1
116 0.11
117 0.11
118 0.1
119 0.12
120 0.17
121 0.21
122 0.28
123 0.31
124 0.33
125 0.37
126 0.37
127 0.36
128 0.34
129 0.36
130 0.34
131 0.33
132 0.32
133 0.3
134 0.31
135 0.31
136 0.27
137 0.2
138 0.21
139 0.21
140 0.22
141 0.28
142 0.36
143 0.44
144 0.5
145 0.55
146 0.54
147 0.61
148 0.65
149 0.67
150 0.66
151 0.68
152 0.68
153 0.69
154 0.67
155 0.62
156 0.6
157 0.57
158 0.58
159 0.56
160 0.58
161 0.62
162 0.67
163 0.69
164 0.76
165 0.75
166 0.77
167 0.81
168 0.83
169 0.83
170 0.86
171 0.88
172 0.89
173 0.94
174 0.94
175 0.94
176 0.93
177 0.87
178 0.82
179 0.75
180 0.75
181 0.7
182 0.62
183 0.53
184 0.5
185 0.44
186 0.38
187 0.34
188 0.24
189 0.17
190 0.14
191 0.11
192 0.06
193 0.06
194 0.06
195 0.06
196 0.05
197 0.07
198 0.07
199 0.08
200 0.08
201 0.09
202 0.11
203 0.16
204 0.18
205 0.19
206 0.19