Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K3Y2

Protein Details
Accession E3K3Y2   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-84KQPGHFSKECPRKKKRINDWNVKLPRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, mito_nucl 13.166, cyto_nucl 12.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG pgr:PGTG_04740  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MGQYKTSYNSIPQVNRSSWRNSNQTSKDEVREDELDSKRPSTSNPQAITGKDVCHFCKQPGHFSKECPRKKKRINDWNVKLPRIFLQLKSRQNLITLRLGEDIFRRLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.46
4 0.47
5 0.47
6 0.5
7 0.52
8 0.51
9 0.58
10 0.57
11 0.57
12 0.57
13 0.54
14 0.51
15 0.46
16 0.43
17 0.37
18 0.34
19 0.32
20 0.33
21 0.31
22 0.32
23 0.3
24 0.3
25 0.26
26 0.25
27 0.25
28 0.26
29 0.32
30 0.35
31 0.35
32 0.38
33 0.39
34 0.39
35 0.4
36 0.32
37 0.25
38 0.2
39 0.21
40 0.19
41 0.22
42 0.22
43 0.2
44 0.25
45 0.25
46 0.33
47 0.37
48 0.42
49 0.39
50 0.43
51 0.52
52 0.56
53 0.62
54 0.62
55 0.63
56 0.67
57 0.75
58 0.81
59 0.82
60 0.83
61 0.85
62 0.87
63 0.87
64 0.87
65 0.83
66 0.74
67 0.64
68 0.54
69 0.47
70 0.43
71 0.38
72 0.33
73 0.37
74 0.44
75 0.51
76 0.52
77 0.51
78 0.45
79 0.47
80 0.45
81 0.39
82 0.38
83 0.32
84 0.31
85 0.3
86 0.3
87 0.28
88 0.27