Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3L8K5

Protein Details
Accession E3L8K5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
101-121TPLRAIRRELNRENRNNIRKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pgr:PGTG_18798  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSSLIRTGLLRLSSHTESKQIYSRATSNLGDRHLASQPTQEKKTSQAKKTVPVSTIPAGSPIKGLAYIKGESDPIAKADDEYPSWLWTLLEPNMGVGHSDTPLRAIRRELNRENRNNIRKSNFLKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.3
4 0.3
5 0.33
6 0.37
7 0.33
8 0.31
9 0.31
10 0.33
11 0.31
12 0.33
13 0.31
14 0.29
15 0.3
16 0.29
17 0.27
18 0.25
19 0.25
20 0.25
21 0.24
22 0.2
23 0.24
24 0.29
25 0.34
26 0.36
27 0.34
28 0.32
29 0.38
30 0.48
31 0.49
32 0.46
33 0.49
34 0.49
35 0.55
36 0.6
37 0.56
38 0.47
39 0.4
40 0.4
41 0.32
42 0.3
43 0.22
44 0.21
45 0.18
46 0.16
47 0.15
48 0.11
49 0.09
50 0.09
51 0.1
52 0.07
53 0.09
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.11
60 0.1
61 0.08
62 0.09
63 0.08
64 0.09
65 0.09
66 0.11
67 0.1
68 0.12
69 0.12
70 0.12
71 0.12
72 0.11
73 0.11
74 0.1
75 0.13
76 0.11
77 0.12
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.1
89 0.15
90 0.17
91 0.18
92 0.21
93 0.28
94 0.37
95 0.46
96 0.53
97 0.59
98 0.67
99 0.73
100 0.78
101 0.8
102 0.8
103 0.77
104 0.76
105 0.71
106 0.69
107 0.68
108 0.71