Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JX73

Protein Details
Accession E3JX73   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-82LYPLNKPNNPKPKPKPKPKPQPKPSIILHydrophilic
NLS Segment(s)
PositionSequence
57-77PLNKPNNPKPKPKPKPKPQPK
Subcellular Location(s) extr 19, E.R. 3, mito 1, cyto 1, plas 1, golg 1, vacu 1, cyto_mito 1
Family & Domain DBs
KEGG pgr:PGTG_02109  -  
Amino Acid Sequences MRLLLIVAALIPFAYLQEPGRQVQRDGTGFVDRLGENEVGDPIAIGIAPAKRKTLYPLNKPNNPKPKPKPKPKPQPKPSIILSDQGGGYIQHPKKENPTLTLYSAADGYYSEMFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.08
4 0.12
5 0.15
6 0.17
7 0.23
8 0.24
9 0.25
10 0.27
11 0.32
12 0.29
13 0.28
14 0.29
15 0.25
16 0.24
17 0.23
18 0.22
19 0.16
20 0.15
21 0.16
22 0.14
23 0.11
24 0.11
25 0.11
26 0.08
27 0.08
28 0.07
29 0.04
30 0.04
31 0.03
32 0.03
33 0.04
34 0.06
35 0.09
36 0.09
37 0.11
38 0.11
39 0.12
40 0.17
41 0.25
42 0.31
43 0.38
44 0.48
45 0.55
46 0.61
47 0.66
48 0.71
49 0.72
50 0.68
51 0.69
52 0.68
53 0.72
54 0.76
55 0.82
56 0.84
57 0.84
58 0.92
59 0.93
60 0.94
61 0.92
62 0.93
63 0.85
64 0.8
65 0.72
66 0.69
67 0.59
68 0.51
69 0.42
70 0.33
71 0.29
72 0.23
73 0.2
74 0.12
75 0.12
76 0.19
77 0.19
78 0.22
79 0.25
80 0.28
81 0.35
82 0.43
83 0.45
84 0.4
85 0.45
86 0.44
87 0.44
88 0.45
89 0.38
90 0.3
91 0.27
92 0.23
93 0.16
94 0.13
95 0.13