Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K772

Protein Details
Accession E3K772    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-97TPQPTRSKRGPRAPARPQKRPRAPAKLLKRPRAPARPQKRSKKPQSPIKAPGTQQHydrophilic
NLS Segment(s)
PositionSequence
48-92RSKRGPRAPARPQKRPRAPAKLLKRPRAPARPQKRSKKPQSPIKA
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 9, cyto 4.5
Family & Domain DBs
KEGG pgr:PGTG_05350  -  
Amino Acid Sequences MFFPPTAWRAPKTPTDPCPLLDGPRGTGSSSDDPDRPPTPWSTPQPTRSKRGPRAPARPQKRPRAPAKLLKRPRAPARPQKRSKKPQSPIKAPGTQQSAPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.52
4 0.49
5 0.51
6 0.44
7 0.4
8 0.38
9 0.33
10 0.28
11 0.29
12 0.28
13 0.22
14 0.21
15 0.23
16 0.21
17 0.22
18 0.22
19 0.21
20 0.22
21 0.26
22 0.27
23 0.23
24 0.21
25 0.22
26 0.25
27 0.31
28 0.35
29 0.38
30 0.43
31 0.5
32 0.58
33 0.59
34 0.59
35 0.6
36 0.65
37 0.64
38 0.68
39 0.7
40 0.68
41 0.74
42 0.78
43 0.8
44 0.78
45 0.8
46 0.8
47 0.81
48 0.81
49 0.8
50 0.78
51 0.78
52 0.77
53 0.77
54 0.79
55 0.79
56 0.79
57 0.79
58 0.77
59 0.76
60 0.78
61 0.78
62 0.78
63 0.78
64 0.8
65 0.82
66 0.86
67 0.89
68 0.9
69 0.91
70 0.93
71 0.93
72 0.92
73 0.91
74 0.92
75 0.9
76 0.88
77 0.85
78 0.81
79 0.72
80 0.7
81 0.66
82 0.57