Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3JU17

Protein Details
Accession E3JU17    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-68KEKIKEWREKRRSGKARSKQTKGSBasic
NLS Segment(s)
PositionSequence
44-72GKEKIKEWREKRRSGKARSKQTKGSKNKG
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 4
Family & Domain DBs
KEGG pgr:PGTG_00873  -  
Amino Acid Sequences MEEGNAAGKASATIPSTLQYSEANNRASMNSGTSGFIKQKLDQGKEKIKEWREKRRSGKARSKQTKGSKNKGNGGADSGTGYSRQYSRNSSEPGSDFDEMAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.14
5 0.15
6 0.13
7 0.15
8 0.21
9 0.25
10 0.25
11 0.24
12 0.25
13 0.24
14 0.25
15 0.22
16 0.17
17 0.14
18 0.13
19 0.14
20 0.14
21 0.16
22 0.15
23 0.17
24 0.18
25 0.17
26 0.21
27 0.27
28 0.3
29 0.33
30 0.38
31 0.43
32 0.44
33 0.46
34 0.48
35 0.48
36 0.53
37 0.55
38 0.59
39 0.58
40 0.65
41 0.69
42 0.73
43 0.76
44 0.76
45 0.8
46 0.78
47 0.82
48 0.82
49 0.8
50 0.79
51 0.79
52 0.8
53 0.78
54 0.78
55 0.75
56 0.72
57 0.74
58 0.72
59 0.65
60 0.55
61 0.5
62 0.41
63 0.33
64 0.28
65 0.21
66 0.14
67 0.12
68 0.12
69 0.11
70 0.13
71 0.16
72 0.19
73 0.24
74 0.29
75 0.36
76 0.4
77 0.39
78 0.42
79 0.41
80 0.41
81 0.41
82 0.37