Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QWF8

Protein Details
Accession E3QWF8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-48FVSLKRSRSYHDRRHHHHRHRQEPQPQPQPQPBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MATRRWYLETSPDRYQFVSLKRSRSYHDRRHHHHRHRQEPQPQPQPQPPTHHCCRDDCAHVSREDWNGLVERERKLREVNDVLTRENYSLKCDLQASNTEGQRLSGLATTLQAENQLLREENASLRCSIENSGGNAAKYLRDLERVRSKLAKVERERDGLVARVRELSRHAHHGVSERIEELRRLVSTWERKFDAVEDHNKRLRRDLDAQRTFIAEQGAKIRVYERVLRRHGFITFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.44
4 0.42
5 0.46
6 0.43
7 0.46
8 0.5
9 0.52
10 0.54
11 0.59
12 0.63
13 0.63
14 0.69
15 0.72
16 0.74
17 0.83
18 0.88
19 0.88
20 0.89
21 0.89
22 0.89
23 0.89
24 0.9
25 0.89
26 0.88
27 0.87
28 0.87
29 0.82
30 0.78
31 0.75
32 0.73
33 0.68
34 0.68
35 0.64
36 0.62
37 0.64
38 0.66
39 0.61
40 0.57
41 0.57
42 0.53
43 0.51
44 0.48
45 0.46
46 0.4
47 0.38
48 0.36
49 0.35
50 0.32
51 0.27
52 0.22
53 0.18
54 0.16
55 0.16
56 0.2
57 0.2
58 0.2
59 0.25
60 0.26
61 0.27
62 0.29
63 0.3
64 0.32
65 0.32
66 0.33
67 0.35
68 0.35
69 0.34
70 0.32
71 0.31
72 0.25
73 0.25
74 0.21
75 0.18
76 0.18
77 0.17
78 0.17
79 0.18
80 0.18
81 0.16
82 0.19
83 0.19
84 0.22
85 0.22
86 0.22
87 0.2
88 0.19
89 0.17
90 0.14
91 0.11
92 0.07
93 0.07
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.07
103 0.07
104 0.06
105 0.06
106 0.07
107 0.07
108 0.09
109 0.11
110 0.11
111 0.1
112 0.11
113 0.11
114 0.11
115 0.11
116 0.13
117 0.12
118 0.13
119 0.16
120 0.16
121 0.16
122 0.16
123 0.15
124 0.12
125 0.11
126 0.12
127 0.09
128 0.15
129 0.16
130 0.23
131 0.32
132 0.33
133 0.35
134 0.37
135 0.36
136 0.36
137 0.42
138 0.44
139 0.4
140 0.45
141 0.47
142 0.46
143 0.46
144 0.41
145 0.36
146 0.31
147 0.29
148 0.23
149 0.2
150 0.21
151 0.21
152 0.2
153 0.21
154 0.24
155 0.24
156 0.29
157 0.3
158 0.26
159 0.28
160 0.32
161 0.33
162 0.29
163 0.26
164 0.21
165 0.22
166 0.22
167 0.21
168 0.17
169 0.17
170 0.15
171 0.14
172 0.16
173 0.23
174 0.32
175 0.36
176 0.4
177 0.39
178 0.39
179 0.39
180 0.38
181 0.38
182 0.35
183 0.4
184 0.42
185 0.47
186 0.52
187 0.56
188 0.55
189 0.55
190 0.52
191 0.49
192 0.52
193 0.56
194 0.62
195 0.63
196 0.64
197 0.57
198 0.56
199 0.49
200 0.41
201 0.35
202 0.24
203 0.2
204 0.23
205 0.25
206 0.23
207 0.23
208 0.23
209 0.22
210 0.26
211 0.33
212 0.36
213 0.43
214 0.5
215 0.52
216 0.54
217 0.53