Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QBF9

Protein Details
Accession E3QBF9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-51DSFCHCVQTRKRDRKSKNITKGSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 12.666, cyto_nucl 2.833
Family & Domain DBs
Amino Acid Sequences RVMEKAVRVHHSTQYSSRTRLKVRLCCDSFCHCVQTRKRDRKSKNITKGSPWHVYPPPPGNPTPAYMSRSKRVAVRRANKDSWKPREKLPTLFCFTNHTPPQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.48
4 0.52
5 0.51
6 0.52
7 0.56
8 0.59
9 0.59
10 0.59
11 0.64
12 0.59
13 0.55
14 0.55
15 0.53
16 0.49
17 0.42
18 0.43
19 0.36
20 0.42
21 0.46
22 0.52
23 0.58
24 0.64
25 0.72
26 0.76
27 0.78
28 0.81
29 0.85
30 0.85
31 0.84
32 0.83
33 0.76
34 0.72
35 0.73
36 0.67
37 0.6
38 0.5
39 0.44
40 0.37
41 0.37
42 0.35
43 0.33
44 0.32
45 0.31
46 0.31
47 0.29
48 0.28
49 0.28
50 0.29
51 0.27
52 0.26
53 0.29
54 0.33
55 0.33
56 0.34
57 0.34
58 0.35
59 0.39
60 0.45
61 0.49
62 0.55
63 0.61
64 0.66
65 0.72
66 0.74
67 0.77
68 0.78
69 0.78
70 0.77
71 0.69
72 0.68
73 0.73
74 0.69
75 0.68
76 0.66
77 0.64
78 0.62
79 0.61
80 0.55
81 0.52
82 0.51
83 0.53
84 0.48