Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3Q6M7

Protein Details
Accession E3Q6M7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
124-145EERLAEYKKKKENKPKVAAKSVHydrophilic
NLS Segment(s)
PositionSequence
131-139KKKKENKPK
Subcellular Location(s) cyto 22, nucl 3.5, mito_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036219  eEF-1beta-like_sf  
IPR018940  EF-1_beta_acid_region_euk  
IPR014038  EF1B_bsu/dsu_GNE  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR014717  Transl_elong_EF1B/ribosomal_S6  
IPR001326  Transl_elong_EF1B_B/D_CS  
Gene Ontology GO:0005853  C:eukaryotic translation elongation factor 1 complex  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF10587  EF-1_beta_acid  
PF00736  EF1_GNE  
PROSITE View protein in PROSITE  
PS00824  EF1BD_1  
PS00825  EF1BD_2  
CDD cd00292  EF1B  
cd10308  GST_C_eEF1b_like  
Amino Acid Sequences MGFADLLTDAGAAMLNSWLTTRSYIVGHTPSQADVVTFKALQSAPDAEKYPHAARWYKHISTYESDFATLPGDASKSYSVYGPEASELPVNPAKAPAAEEEDEDVDLFGSDDEEEDAEAARIREERLAEYKKKKENKPKVAAKSVVTMDVKPWDDETPMAELEAAVRAIEHDGLVWGASKLVPVGFGIKKLQINLVVEDEKISLSDLEEEISAIEDYVQSVDIAAMQKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.07
6 0.08
7 0.1
8 0.1
9 0.11
10 0.12
11 0.14
12 0.18
13 0.2
14 0.2
15 0.22
16 0.22
17 0.2
18 0.2
19 0.19
20 0.15
21 0.12
22 0.13
23 0.13
24 0.12
25 0.12
26 0.14
27 0.14
28 0.14
29 0.16
30 0.18
31 0.18
32 0.21
33 0.23
34 0.2
35 0.22
36 0.27
37 0.26
38 0.25
39 0.28
40 0.3
41 0.29
42 0.37
43 0.43
44 0.39
45 0.41
46 0.41
47 0.4
48 0.38
49 0.42
50 0.36
51 0.29
52 0.28
53 0.24
54 0.21
55 0.18
56 0.14
57 0.1
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.08
64 0.09
65 0.1
66 0.1
67 0.11
68 0.12
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.09
75 0.12
76 0.13
77 0.13
78 0.12
79 0.12
80 0.12
81 0.11
82 0.12
83 0.09
84 0.12
85 0.12
86 0.12
87 0.12
88 0.12
89 0.12
90 0.11
91 0.09
92 0.05
93 0.05
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.05
108 0.05
109 0.06
110 0.08
111 0.08
112 0.1
113 0.16
114 0.22
115 0.29
116 0.36
117 0.43
118 0.49
119 0.57
120 0.64
121 0.69
122 0.74
123 0.78
124 0.8
125 0.82
126 0.81
127 0.8
128 0.74
129 0.64
130 0.57
131 0.47
132 0.42
133 0.34
134 0.27
135 0.21
136 0.23
137 0.22
138 0.18
139 0.19
140 0.15
141 0.14
142 0.15
143 0.15
144 0.12
145 0.11
146 0.11
147 0.09
148 0.08
149 0.08
150 0.09
151 0.07
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.05
158 0.04
159 0.05
160 0.05
161 0.05
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.06
171 0.11
172 0.12
173 0.14
174 0.16
175 0.2
176 0.22
177 0.22
178 0.25
179 0.23
180 0.24
181 0.24
182 0.27
183 0.23
184 0.22
185 0.22
186 0.2
187 0.15
188 0.14
189 0.12
190 0.08
191 0.08
192 0.1
193 0.1
194 0.1
195 0.1
196 0.1
197 0.09
198 0.1
199 0.09
200 0.07
201 0.07
202 0.06
203 0.07
204 0.07
205 0.08
206 0.06
207 0.06
208 0.06
209 0.09