Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QL80

Protein Details
Accession E3QL80   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 11, nucl 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLYKDVQSYRLVTVAVLVDRLKINGSLARRCLADLEEKGIIKPVVMHSKMKIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.33
16 0.25
17 0.18
18 0.17
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.14
25 0.15
26 0.19
27 0.21
28 0.23
29 0.27
30 0.28
31 0.25
32 0.23
33 0.22
34 0.17
35 0.15
36 0.12
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.08
46 0.1
47 0.14
48 0.16
49 0.17
50 0.19
51 0.18
52 0.18
53 0.19
54 0.17
55 0.2
56 0.17
57 0.19
58 0.21
59 0.21
60 0.21
61 0.23
62 0.21
63 0.15
64 0.16
65 0.19
66 0.25
67 0.27
68 0.3
69 0.29
70 0.37
71 0.41
72 0.42
73 0.42
74 0.36
75 0.39
76 0.4