Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3Q429

Protein Details
Accession E3Q429    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-157TESSHQPAKATKNKKKRKGGKGKPQEPKPDLRKRTBasic
NLS Segment(s)
PositionSequence
131-156KATKNKKKRKGGKGKPQEPKPDLRKR
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MSTQFAAPNVSKDDLMTFSETHFSDAALGRFKSDFFNPNQQSDAVNSGPSFEEDGDIIEEDDGLGYYSDGVKRTLTDEQIAMFRHSELEALRREQERAAERRSTVPYPNQAGEAGNDGSLKVTESSHQPAKATKNKKKRKGGKGKPQEPKPDLRKRTWDVVEAGLDTLDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.17
5 0.16
6 0.2
7 0.2
8 0.2
9 0.18
10 0.15
11 0.16
12 0.18
13 0.19
14 0.2
15 0.2
16 0.19
17 0.2
18 0.2
19 0.2
20 0.21
21 0.24
22 0.24
23 0.35
24 0.36
25 0.38
26 0.39
27 0.36
28 0.33
29 0.3
30 0.29
31 0.18
32 0.17
33 0.15
34 0.14
35 0.14
36 0.14
37 0.13
38 0.09
39 0.09
40 0.08
41 0.09
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.05
55 0.06
56 0.07
57 0.08
58 0.08
59 0.08
60 0.11
61 0.13
62 0.13
63 0.13
64 0.12
65 0.12
66 0.15
67 0.15
68 0.13
69 0.11
70 0.1
71 0.1
72 0.09
73 0.09
74 0.07
75 0.1
76 0.11
77 0.12
78 0.16
79 0.16
80 0.17
81 0.16
82 0.21
83 0.23
84 0.26
85 0.28
86 0.28
87 0.28
88 0.32
89 0.35
90 0.32
91 0.3
92 0.3
93 0.32
94 0.33
95 0.32
96 0.29
97 0.25
98 0.23
99 0.2
100 0.19
101 0.14
102 0.11
103 0.1
104 0.09
105 0.09
106 0.09
107 0.09
108 0.06
109 0.07
110 0.08
111 0.12
112 0.18
113 0.22
114 0.23
115 0.23
116 0.27
117 0.36
118 0.44
119 0.5
120 0.55
121 0.61
122 0.71
123 0.8
124 0.87
125 0.88
126 0.9
127 0.91
128 0.93
129 0.93
130 0.94
131 0.94
132 0.93
133 0.91
134 0.9
135 0.84
136 0.83
137 0.82
138 0.81
139 0.78
140 0.75
141 0.76
142 0.71
143 0.76
144 0.69
145 0.64
146 0.56
147 0.53
148 0.47
149 0.38
150 0.33
151 0.23