Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QG84

Protein Details
Accession E3QG84    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-115LIERGFPGRRGKKGRKDQGFQRENVBasic
NLS Segment(s)
PositionSequence
97-106PGRRGKKGRK
Subcellular Location(s) mito 10, nucl 8, cyto 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MDIQTLEAYGVQVRKPPTMTVSGKTELEKKKTKRWGDLKMEVMEYASNASIARNLVETLMAPAELGEATSHMTRSKAAGTRNWPSRPMFSLIERGFPGRRGKKGRKDQGFQRENVTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.24
5 0.31
6 0.33
7 0.33
8 0.36
9 0.36
10 0.35
11 0.36
12 0.41
13 0.39
14 0.43
15 0.48
16 0.48
17 0.54
18 0.63
19 0.66
20 0.68
21 0.71
22 0.73
23 0.73
24 0.75
25 0.7
26 0.62
27 0.57
28 0.47
29 0.38
30 0.28
31 0.19
32 0.13
33 0.07
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.03
50 0.04
51 0.03
52 0.04
53 0.03
54 0.03
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.13
63 0.15
64 0.18
65 0.23
66 0.29
67 0.36
68 0.44
69 0.45
70 0.44
71 0.43
72 0.43
73 0.41
74 0.4
75 0.34
76 0.29
77 0.36
78 0.33
79 0.35
80 0.32
81 0.32
82 0.29
83 0.31
84 0.39
85 0.36
86 0.45
87 0.51
88 0.61
89 0.68
90 0.78
91 0.84
92 0.84
93 0.85
94 0.86
95 0.87
96 0.84
97 0.75
98 0.7