Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QQS3

Protein Details
Accession E3QQS3   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-56LPEGPWRRKVEKKKLELIHKAKVBasic
221-247ADAADRYEPRKPRRPRKPGYYEKQLAHBasic
NLS Segment(s)
PositionSequence
21-66AKKRKGFRVGPDNLPEGPWRRKVEKKKLELIHKAKVKKAYAKIKER
229-297PRKPRRPRKPGYYEKQLAHAEQKRAEAEARRAEIQRRHEERERKTADRERYRRAMAKARKGGQDGQRRL
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAPKRAAEGAAAASSKDAQQAKKRKGFRVGPDNLPEGPWRRKVEKKKLELIHKAKVKKAYAKIKERELASQASSKARQPAAAAAAAAAVAAGPSTKEASKGASSDDELDDVEEPQTTQETSDSAITRTAISTEAEAAAAAPAPATSGLSSPTEATPAQPLEGEIHPSRAEMITNDGELPNPNTVAVKRKRGAATATGSNAELPGTRTASAPAASNGTEDAADAADRYEPRKPRRPRKPGYYEKQLAHAEQKRAEAEARRAEIQRRHEERERKTADRERYRRAMAKARKGGQDGQRRLGRESALLLEKVKRIVGDSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.19
4 0.21
5 0.25
6 0.35
7 0.45
8 0.55
9 0.63
10 0.69
11 0.71
12 0.76
13 0.78
14 0.78
15 0.79
16 0.76
17 0.74
18 0.72
19 0.68
20 0.58
21 0.51
22 0.45
23 0.41
24 0.41
25 0.42
26 0.43
27 0.47
28 0.56
29 0.66
30 0.72
31 0.76
32 0.77
33 0.79
34 0.81
35 0.84
36 0.85
37 0.8
38 0.78
39 0.75
40 0.72
41 0.67
42 0.66
43 0.63
44 0.61
45 0.64
46 0.65
47 0.68
48 0.73
49 0.74
50 0.74
51 0.73
52 0.66
53 0.6
54 0.53
55 0.46
56 0.38
57 0.37
58 0.32
59 0.32
60 0.32
61 0.3
62 0.33
63 0.3
64 0.29
65 0.26
66 0.27
67 0.24
68 0.23
69 0.2
70 0.14
71 0.13
72 0.11
73 0.1
74 0.06
75 0.03
76 0.02
77 0.02
78 0.02
79 0.02
80 0.03
81 0.05
82 0.06
83 0.07
84 0.08
85 0.11
86 0.12
87 0.13
88 0.14
89 0.14
90 0.15
91 0.16
92 0.16
93 0.13
94 0.12
95 0.12
96 0.1
97 0.09
98 0.09
99 0.06
100 0.06
101 0.06
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.1
109 0.1
110 0.1
111 0.11
112 0.11
113 0.11
114 0.1
115 0.1
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.02
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.05
135 0.06
136 0.07
137 0.07
138 0.07
139 0.09
140 0.09
141 0.09
142 0.1
143 0.09
144 0.09
145 0.08
146 0.09
147 0.1
148 0.1
149 0.14
150 0.11
151 0.13
152 0.13
153 0.13
154 0.13
155 0.1
156 0.1
157 0.07
158 0.1
159 0.09
160 0.1
161 0.1
162 0.1
163 0.1
164 0.1
165 0.11
166 0.08
167 0.08
168 0.07
169 0.08
170 0.09
171 0.18
172 0.22
173 0.28
174 0.29
175 0.35
176 0.36
177 0.37
178 0.38
179 0.34
180 0.34
181 0.29
182 0.29
183 0.24
184 0.23
185 0.21
186 0.18
187 0.13
188 0.1
189 0.08
190 0.09
191 0.1
192 0.1
193 0.11
194 0.12
195 0.13
196 0.13
197 0.12
198 0.11
199 0.11
200 0.11
201 0.11
202 0.1
203 0.09
204 0.08
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.07
212 0.08
213 0.1
214 0.16
215 0.24
216 0.32
217 0.43
218 0.53
219 0.61
220 0.72
221 0.81
222 0.84
223 0.87
224 0.9
225 0.91
226 0.89
227 0.89
228 0.85
229 0.75
230 0.73
231 0.64
232 0.55
233 0.54
234 0.52
235 0.46
236 0.42
237 0.44
238 0.37
239 0.37
240 0.39
241 0.34
242 0.35
243 0.37
244 0.37
245 0.38
246 0.4
247 0.46
248 0.48
249 0.52
250 0.55
251 0.54
252 0.59
253 0.64
254 0.7
255 0.7
256 0.74
257 0.73
258 0.66
259 0.7
260 0.71
261 0.73
262 0.75
263 0.75
264 0.73
265 0.73
266 0.76
267 0.74
268 0.72
269 0.72
270 0.7
271 0.74
272 0.75
273 0.74
274 0.73
275 0.7
276 0.71
277 0.7
278 0.71
279 0.66
280 0.65
281 0.63
282 0.6
283 0.58
284 0.54
285 0.46
286 0.37
287 0.34
288 0.31
289 0.3
290 0.3
291 0.29
292 0.3
293 0.31
294 0.31
295 0.29
296 0.24