Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3QLV8

Protein Details
Accession E3QLV8    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKFDRRAKSQPKHGKPSDSGHydrophilic
33-58HPGWTGPGYLQKKKPRRPSTASGSAEHydrophilic
NLS Segment(s)
PositionSequence
6-50RRAKSQPKHGKPSDSGASKAPPPLPRGHPGWTGPGYLQKKKPRRP
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021463  Methyltransf_34  
Pfam View protein in Pfam  
PF11312  Methyltransf_34  
Amino Acid Sequences MAKFDRRAKSQPKHGKPSDSGASKAPPPLPRGHPGWTGPGYLQKKKPRRPSTASGSAEPRRLDSVLSVRLEQLMINVFRTAFPACNDFEALKPTLQEINRALSLREFDIAFGKAEYLEAYAIRWSPSRALAYAQLMAWICEEMADDACVQRLIGCDSDNEQKTAKVVCFGGGAAEIMAFSGLLRHLQPSAAVGRPELPPNCEDASKDLQALSVPEREITPPLINLDLIDTADWSAVLSKLHECLETPPTLSKYASAAARASNASFLLPGAVRHTFTRANVLSYSTEDLHAAIGPDPALLTLLFTLNELYTASISQTTSFLLKVTEAAPKGSLLLVLDSPGSYSETAVCNAKEGEEKKKYPMSYLMDYALVPKPNKKAADVVPESGEDKSTPAWEKVISEDNVLYKLQRDLEYPVSLENMRFQVHVLKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.78
4 0.76
5 0.75
6 0.67
7 0.59
8 0.53
9 0.51
10 0.45
11 0.47
12 0.44
13 0.4
14 0.4
15 0.46
16 0.47
17 0.49
18 0.5
19 0.5
20 0.5
21 0.47
22 0.51
23 0.45
24 0.4
25 0.36
26 0.41
27 0.43
28 0.45
29 0.52
30 0.55
31 0.63
32 0.71
33 0.81
34 0.81
35 0.84
36 0.84
37 0.85
38 0.84
39 0.84
40 0.78
41 0.72
42 0.7
43 0.65
44 0.62
45 0.53
46 0.45
47 0.38
48 0.34
49 0.29
50 0.26
51 0.28
52 0.29
53 0.3
54 0.29
55 0.26
56 0.27
57 0.26
58 0.22
59 0.17
60 0.16
61 0.15
62 0.15
63 0.16
64 0.15
65 0.15
66 0.17
67 0.17
68 0.13
69 0.14
70 0.16
71 0.16
72 0.17
73 0.19
74 0.18
75 0.17
76 0.2
77 0.2
78 0.18
79 0.17
80 0.17
81 0.22
82 0.21
83 0.25
84 0.23
85 0.25
86 0.27
87 0.27
88 0.26
89 0.22
90 0.23
91 0.19
92 0.19
93 0.15
94 0.12
95 0.15
96 0.15
97 0.14
98 0.12
99 0.11
100 0.09
101 0.09
102 0.09
103 0.07
104 0.07
105 0.06
106 0.07
107 0.08
108 0.08
109 0.1
110 0.1
111 0.1
112 0.12
113 0.15
114 0.17
115 0.16
116 0.17
117 0.19
118 0.2
119 0.2
120 0.18
121 0.17
122 0.15
123 0.15
124 0.13
125 0.1
126 0.08
127 0.07
128 0.07
129 0.05
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.06
137 0.06
138 0.07
139 0.08
140 0.08
141 0.09
142 0.09
143 0.12
144 0.2
145 0.2
146 0.21
147 0.19
148 0.19
149 0.2
150 0.22
151 0.19
152 0.14
153 0.13
154 0.12
155 0.12
156 0.11
157 0.1
158 0.08
159 0.08
160 0.05
161 0.05
162 0.04
163 0.03
164 0.03
165 0.03
166 0.02
167 0.03
168 0.03
169 0.04
170 0.05
171 0.05
172 0.06
173 0.06
174 0.06
175 0.07
176 0.1
177 0.11
178 0.11
179 0.1
180 0.12
181 0.14
182 0.18
183 0.17
184 0.16
185 0.15
186 0.18
187 0.19
188 0.17
189 0.16
190 0.16
191 0.2
192 0.19
193 0.19
194 0.15
195 0.14
196 0.14
197 0.15
198 0.12
199 0.1
200 0.09
201 0.09
202 0.1
203 0.1
204 0.11
205 0.12
206 0.1
207 0.09
208 0.1
209 0.1
210 0.09
211 0.08
212 0.08
213 0.06
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.04
220 0.03
221 0.04
222 0.04
223 0.05
224 0.05
225 0.06
226 0.08
227 0.09
228 0.09
229 0.09
230 0.11
231 0.14
232 0.14
233 0.14
234 0.15
235 0.16
236 0.18
237 0.17
238 0.15
239 0.13
240 0.16
241 0.15
242 0.14
243 0.13
244 0.12
245 0.14
246 0.14
247 0.12
248 0.1
249 0.09
250 0.08
251 0.07
252 0.07
253 0.06
254 0.06
255 0.06
256 0.09
257 0.09
258 0.11
259 0.11
260 0.15
261 0.15
262 0.15
263 0.23
264 0.2
265 0.21
266 0.21
267 0.22
268 0.2
269 0.2
270 0.22
271 0.15
272 0.15
273 0.13
274 0.12
275 0.11
276 0.1
277 0.09
278 0.07
279 0.07
280 0.07
281 0.06
282 0.06
283 0.06
284 0.06
285 0.05
286 0.04
287 0.05
288 0.05
289 0.05
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.07
300 0.08
301 0.08
302 0.08
303 0.09
304 0.09
305 0.09
306 0.09
307 0.08
308 0.08
309 0.09
310 0.1
311 0.14
312 0.14
313 0.15
314 0.15
315 0.15
316 0.15
317 0.14
318 0.13
319 0.08
320 0.09
321 0.08
322 0.08
323 0.08
324 0.07
325 0.08
326 0.08
327 0.09
328 0.07
329 0.08
330 0.1
331 0.11
332 0.13
333 0.16
334 0.15
335 0.15
336 0.15
337 0.16
338 0.21
339 0.22
340 0.31
341 0.37
342 0.39
343 0.43
344 0.49
345 0.48
346 0.45
347 0.5
348 0.47
349 0.42
350 0.43
351 0.38
352 0.33
353 0.32
354 0.33
355 0.29
356 0.28
357 0.25
358 0.28
359 0.32
360 0.38
361 0.4
362 0.38
363 0.41
364 0.42
365 0.51
366 0.49
367 0.46
368 0.41
369 0.41
370 0.4
371 0.33
372 0.28
373 0.17
374 0.15
375 0.14
376 0.18
377 0.2
378 0.2
379 0.22
380 0.22
381 0.23
382 0.26
383 0.32
384 0.28
385 0.26
386 0.27
387 0.27
388 0.28
389 0.27
390 0.23
391 0.18
392 0.21
393 0.23
394 0.22
395 0.23
396 0.26
397 0.31
398 0.33
399 0.31
400 0.29
401 0.27
402 0.27
403 0.25
404 0.25
405 0.23
406 0.22
407 0.21
408 0.21
409 0.27