Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3R0Y6

Protein Details
Accession E3R0Y6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-27VSANCGGWRCRRKRPVFPALRGMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MSLWVSANCGGWRCRRKRPVFPALRGMVSDTAATELQLVFEARDVRKRVAERKEGFAAAVARAENKWPDRQLLAGLVFSRWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.68
4 0.76
5 0.82
6 0.83
7 0.82
8 0.81
9 0.79
10 0.71
11 0.63
12 0.52
13 0.45
14 0.34
15 0.25
16 0.2
17 0.11
18 0.1
19 0.09
20 0.09
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.04
27 0.06
28 0.09
29 0.09
30 0.15
31 0.17
32 0.17
33 0.22
34 0.26
35 0.32
36 0.37
37 0.46
38 0.44
39 0.47
40 0.49
41 0.44
42 0.41
43 0.35
44 0.29
45 0.2
46 0.19
47 0.13
48 0.12
49 0.12
50 0.14
51 0.17
52 0.19
53 0.25
54 0.25
55 0.28
56 0.28
57 0.29
58 0.29
59 0.28
60 0.26
61 0.23
62 0.22