Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3R0K0

Protein Details
Accession E3R0K0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPNKKPKSNKKARSIKGWSLYSHydrophilic
NLS Segment(s)
PositionSequence
4-13KKPKSNKKAR
Subcellular Location(s) nucl 15.5, mito_nucl 13, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MPNKKPKSNKKARSIKGWSLYSALHNDVLQLLQEDNLTFKFHNDDNDDNSRRDYDTNIMGQFACRNHACHANGWASKRIPVTIRMYDGQRYNARVYHQRCRQCNSLSRPTLDSSYAERVAYRLKVWCGIPMQPPNFVRKPAKKPHASELCEGCKAGHCREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.81
4 0.73
5 0.63
6 0.55
7 0.5
8 0.43
9 0.37
10 0.3
11 0.22
12 0.2
13 0.18
14 0.17
15 0.15
16 0.12
17 0.1
18 0.08
19 0.07
20 0.08
21 0.08
22 0.08
23 0.09
24 0.11
25 0.1
26 0.1
27 0.13
28 0.14
29 0.19
30 0.22
31 0.24
32 0.28
33 0.37
34 0.39
35 0.36
36 0.37
37 0.33
38 0.29
39 0.27
40 0.24
41 0.18
42 0.18
43 0.2
44 0.19
45 0.19
46 0.17
47 0.17
48 0.18
49 0.15
50 0.15
51 0.13
52 0.14
53 0.15
54 0.22
55 0.23
56 0.21
57 0.24
58 0.26
59 0.28
60 0.28
61 0.3
62 0.24
63 0.26
64 0.25
65 0.23
66 0.19
67 0.21
68 0.23
69 0.21
70 0.23
71 0.22
72 0.23
73 0.24
74 0.25
75 0.25
76 0.23
77 0.24
78 0.23
79 0.23
80 0.25
81 0.3
82 0.33
83 0.38
84 0.44
85 0.49
86 0.51
87 0.54
88 0.57
89 0.55
90 0.59
91 0.57
92 0.59
93 0.55
94 0.54
95 0.51
96 0.46
97 0.43
98 0.35
99 0.29
100 0.23
101 0.25
102 0.24
103 0.21
104 0.19
105 0.19
106 0.21
107 0.21
108 0.19
109 0.18
110 0.18
111 0.22
112 0.22
113 0.25
114 0.24
115 0.27
116 0.32
117 0.36
118 0.37
119 0.4
120 0.41
121 0.45
122 0.45
123 0.48
124 0.51
125 0.52
126 0.6
127 0.64
128 0.72
129 0.73
130 0.76
131 0.79
132 0.8
133 0.75
134 0.72
135 0.69
136 0.64
137 0.58
138 0.53
139 0.43
140 0.41
141 0.41