Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QY29

Protein Details
Accession E3QY29   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
299-319IRSYASRERRHSRREVPPLRGBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046497  DUF6590  
Pfam View protein in Pfam  
PF20233  DUF6590  
Amino Acid Sequences MVIGNRDFSTFRSKSTKSTKSDSGNGDDASIGTHDSSYEHPLARKGYDIGPASRCEVGDVFEFLWADSHEFEWEWKCLGYTRFIVLRHSDTFPHHCVCVPISTPTKNDFQKPGIDSSQQGYVFDENDRTPPFDRLPFSPVGMQLRPGKFRVKENSRANYADVLEIDHDAQVMVIGDVTRYFDRVRRNVNKAVMRHVLKKALEQYREGKLVDKKGAMLEASVVNGGSQDDDEPEGESDPDHPDVFLMPDETASVIEKRQPESLISAEMPPPPPPAPPLPPMDSPMPIQQPSPPRDDASSIRSYASRERRHSRREVPPLRGEDLPRKMSDQHVDGASRPYRQRIDLPRSRSHRHSEHETGSMYDVATAKMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.54
3 0.61
4 0.57
5 0.63
6 0.66
7 0.64
8 0.7
9 0.66
10 0.62
11 0.57
12 0.51
13 0.45
14 0.36
15 0.29
16 0.23
17 0.18
18 0.12
19 0.08
20 0.08
21 0.07
22 0.09
23 0.11
24 0.15
25 0.19
26 0.21
27 0.22
28 0.26
29 0.29
30 0.28
31 0.29
32 0.26
33 0.25
34 0.3
35 0.31
36 0.32
37 0.32
38 0.33
39 0.33
40 0.32
41 0.29
42 0.24
43 0.21
44 0.18
45 0.17
46 0.17
47 0.14
48 0.14
49 0.15
50 0.12
51 0.13
52 0.12
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.12
59 0.14
60 0.14
61 0.14
62 0.13
63 0.14
64 0.17
65 0.18
66 0.2
67 0.19
68 0.22
69 0.25
70 0.25
71 0.28
72 0.28
73 0.31
74 0.3
75 0.3
76 0.28
77 0.29
78 0.34
79 0.35
80 0.33
81 0.29
82 0.26
83 0.26
84 0.25
85 0.23
86 0.19
87 0.21
88 0.24
89 0.26
90 0.28
91 0.29
92 0.35
93 0.34
94 0.37
95 0.36
96 0.34
97 0.38
98 0.37
99 0.39
100 0.35
101 0.33
102 0.3
103 0.27
104 0.31
105 0.24
106 0.22
107 0.19
108 0.17
109 0.17
110 0.16
111 0.17
112 0.12
113 0.15
114 0.16
115 0.17
116 0.17
117 0.19
118 0.21
119 0.23
120 0.25
121 0.24
122 0.27
123 0.25
124 0.25
125 0.23
126 0.23
127 0.23
128 0.21
129 0.23
130 0.25
131 0.27
132 0.28
133 0.29
134 0.32
135 0.31
136 0.37
137 0.43
138 0.44
139 0.51
140 0.57
141 0.6
142 0.58
143 0.56
144 0.51
145 0.43
146 0.36
147 0.27
148 0.19
149 0.14
150 0.11
151 0.1
152 0.09
153 0.07
154 0.06
155 0.05
156 0.05
157 0.04
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.05
165 0.05
166 0.06
167 0.07
168 0.11
169 0.17
170 0.21
171 0.3
172 0.36
173 0.41
174 0.45
175 0.51
176 0.53
177 0.48
178 0.49
179 0.47
180 0.42
181 0.41
182 0.38
183 0.37
184 0.32
185 0.33
186 0.36
187 0.35
188 0.34
189 0.33
190 0.35
191 0.33
192 0.35
193 0.33
194 0.3
195 0.28
196 0.31
197 0.3
198 0.27
199 0.23
200 0.22
201 0.22
202 0.17
203 0.13
204 0.1
205 0.08
206 0.08
207 0.07
208 0.06
209 0.05
210 0.05
211 0.05
212 0.04
213 0.04
214 0.04
215 0.05
216 0.06
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.07
223 0.08
224 0.1
225 0.11
226 0.1
227 0.09
228 0.09
229 0.1
230 0.1
231 0.09
232 0.08
233 0.06
234 0.06
235 0.07
236 0.07
237 0.07
238 0.07
239 0.08
240 0.08
241 0.12
242 0.14
243 0.16
244 0.18
245 0.19
246 0.18
247 0.21
248 0.21
249 0.2
250 0.18
251 0.18
252 0.18
253 0.19
254 0.2
255 0.18
256 0.2
257 0.18
258 0.18
259 0.2
260 0.23
261 0.25
262 0.28
263 0.32
264 0.33
265 0.34
266 0.37
267 0.35
268 0.32
269 0.3
270 0.31
271 0.3
272 0.26
273 0.26
274 0.28
275 0.34
276 0.35
277 0.39
278 0.35
279 0.33
280 0.34
281 0.37
282 0.35
283 0.33
284 0.34
285 0.29
286 0.29
287 0.28
288 0.29
289 0.34
290 0.41
291 0.43
292 0.48
293 0.57
294 0.65
295 0.72
296 0.78
297 0.79
298 0.79
299 0.81
300 0.81
301 0.8
302 0.79
303 0.76
304 0.7
305 0.64
306 0.58
307 0.56
308 0.55
309 0.52
310 0.45
311 0.43
312 0.41
313 0.44
314 0.45
315 0.38
316 0.35
317 0.34
318 0.34
319 0.33
320 0.39
321 0.36
322 0.36
323 0.36
324 0.39
325 0.39
326 0.41
327 0.49
328 0.52
329 0.59
330 0.61
331 0.65
332 0.68
333 0.72
334 0.75
335 0.73
336 0.72
337 0.7
338 0.69
339 0.71
340 0.69
341 0.66
342 0.64
343 0.59
344 0.51
345 0.45
346 0.39
347 0.29
348 0.24
349 0.2