Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QGB5

Protein Details
Accession E3QGB5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23GSTPYRCRFKLRPRGCQVVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MSTGSTPYRCRFKLRPRGCQVVSHGRGLAGERARGENGDGYGKVLSTGLPDGVWLHRLCSTTGIHATGGRLVFFSFRISAALKIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.75
4 0.82
5 0.76
6 0.71
7 0.67
8 0.67
9 0.6
10 0.51
11 0.44
12 0.34
13 0.33
14 0.29
15 0.27
16 0.18
17 0.17
18 0.16
19 0.17
20 0.17
21 0.17
22 0.16
23 0.12
24 0.11
25 0.11
26 0.1
27 0.09
28 0.09
29 0.09
30 0.08
31 0.07
32 0.06
33 0.05
34 0.06
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.1
41 0.09
42 0.1
43 0.12
44 0.14
45 0.14
46 0.16
47 0.16
48 0.17
49 0.19
50 0.18
51 0.16
52 0.16
53 0.17
54 0.17
55 0.17
56 0.13
57 0.12
58 0.11
59 0.11
60 0.11
61 0.13
62 0.11
63 0.11
64 0.13
65 0.14