Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q3J7

Protein Details
Accession E3Q3J7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-70GRIVWFPRKKNKPGRASRGRQBasic
NLS Segment(s)
PositionSequence
56-68PRKKNKPGRASRG
98-103IGRRKR
Subcellular Location(s) nucl 11, mito 7, extr 4, plas 3
Family & Domain DBs
Amino Acid Sequences MASNRHHGLGGTSGLVICFQGYIPSGFRLSIFSLLFFFFYPKPPPQNGDGRIVWFPRKKNKPGRASRGRQASSFLFSYSQHGYPKERRQSISEPLRGIGRRKREGREVAALDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.06
5 0.05
6 0.05
7 0.06
8 0.07
9 0.08
10 0.1
11 0.11
12 0.12
13 0.12
14 0.12
15 0.13
16 0.14
17 0.16
18 0.15
19 0.13
20 0.14
21 0.14
22 0.14
23 0.12
24 0.13
25 0.1
26 0.13
27 0.17
28 0.19
29 0.24
30 0.25
31 0.27
32 0.29
33 0.37
34 0.36
35 0.37
36 0.34
37 0.32
38 0.32
39 0.31
40 0.32
41 0.28
42 0.3
43 0.34
44 0.41
45 0.47
46 0.56
47 0.63
48 0.68
49 0.74
50 0.8
51 0.81
52 0.79
53 0.78
54 0.77
55 0.69
56 0.59
57 0.53
58 0.44
59 0.37
60 0.32
61 0.26
62 0.18
63 0.17
64 0.2
65 0.19
66 0.2
67 0.2
68 0.21
69 0.27
70 0.34
71 0.44
72 0.5
73 0.52
74 0.52
75 0.55
76 0.59
77 0.63
78 0.64
79 0.59
80 0.51
81 0.47
82 0.51
83 0.47
84 0.49
85 0.47
86 0.47
87 0.51
88 0.57
89 0.62
90 0.65
91 0.69
92 0.68
93 0.7