Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3QNW4

Protein Details
Accession E3QNW4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-68AIAQHKKPRRVIRPRPQHATPHydrophilic
NLS Segment(s)
PositionSequence
53-60KKPRRVIR
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 3, pero 2
Family & Domain DBs
Amino Acid Sequences MKLSLEQKNPLAKKVENTDSAKAAIQNNTNQTATTGESFSTGKSAAAAIAQHKKPRRVIRPRPQHATPLDTVDDDDYDDCWLPAYEDPQPTDRLVDDDWVSVKKPASAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.47
4 0.5
5 0.48
6 0.45
7 0.44
8 0.38
9 0.34
10 0.31
11 0.27
12 0.26
13 0.27
14 0.29
15 0.31
16 0.3
17 0.27
18 0.24
19 0.21
20 0.19
21 0.16
22 0.13
23 0.1
24 0.11
25 0.12
26 0.11
27 0.1
28 0.09
29 0.07
30 0.07
31 0.07
32 0.05
33 0.06
34 0.07
35 0.09
36 0.16
37 0.18
38 0.23
39 0.27
40 0.31
41 0.37
42 0.45
43 0.52
44 0.56
45 0.65
46 0.71
47 0.78
48 0.81
49 0.81
50 0.74
51 0.7
52 0.61
53 0.55
54 0.45
55 0.38
56 0.31
57 0.25
58 0.23
59 0.17
60 0.15
61 0.11
62 0.1
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.12
72 0.15
73 0.18
74 0.21
75 0.22
76 0.25
77 0.24
78 0.24
79 0.22
80 0.2
81 0.18
82 0.19
83 0.18
84 0.17
85 0.19
86 0.19
87 0.2
88 0.2
89 0.2