Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QBD0

Protein Details
Accession E3QBD0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKRKSSSKPQGPKKKDPLPSKFTCHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKSSSKPQGPKKK
Subcellular Location(s) mito 15, cyto 8.5, cyto_nucl 6.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKKKDPLPSKFTCLFCNHEDSVAVKLDKKAGVGSLDCRVCGQMFQCSINYLSAAVDVYGEWVDAADAVAKEAGPTAGSQSKIPSARRAPPSRPVNDDDDDDDQRYGGEGVDLDDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.87
4 0.86
5 0.84
6 0.81
7 0.77
8 0.74
9 0.71
10 0.64
11 0.59
12 0.53
13 0.48
14 0.42
15 0.43
16 0.36
17 0.3
18 0.29
19 0.25
20 0.24
21 0.22
22 0.2
23 0.16
24 0.17
25 0.19
26 0.18
27 0.18
28 0.16
29 0.13
30 0.14
31 0.14
32 0.15
33 0.18
34 0.18
35 0.17
36 0.17
37 0.16
38 0.14
39 0.14
40 0.13
41 0.11
42 0.12
43 0.13
44 0.13
45 0.14
46 0.15
47 0.14
48 0.13
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.04
55 0.03
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.04
73 0.04
74 0.07
75 0.11
76 0.12
77 0.12
78 0.14
79 0.19
80 0.24
81 0.26
82 0.3
83 0.32
84 0.4
85 0.49
86 0.54
87 0.53
88 0.59
89 0.66
90 0.63
91 0.62
92 0.58
93 0.54
94 0.5
95 0.48
96 0.42
97 0.39
98 0.37
99 0.34
100 0.3
101 0.24
102 0.21
103 0.2
104 0.16
105 0.1
106 0.08
107 0.07
108 0.08
109 0.1