Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q9V5

Protein Details
Accession E3Q9V5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
145-171RAYDRAVKEKERKRREEEKAADKRRLEBasic
NLS Segment(s)
PositionSequence
151-175VKEKERKRREEEKAADKRRLEAAEK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MPSSSQKPDLPSSLSKLSIDSSNKKPAAKKIKEPVADSWEDEDVDDEEEGGNDDDKGEREGTATPQADGSKAPPPTPISPTYSAADRSFSPYAAADPSAPSASSSPAASSGSSGARRPEKTDAVARRMIASALGVKVPRMTEEQRAYDRAVKEKERKRREEEKAADKRRLEAAEKAKAAIWED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.31
4 0.29
5 0.31
6 0.34
7 0.34
8 0.36
9 0.44
10 0.47
11 0.5
12 0.52
13 0.56
14 0.6
15 0.61
16 0.64
17 0.65
18 0.71
19 0.71
20 0.7
21 0.66
22 0.61
23 0.55
24 0.47
25 0.4
26 0.32
27 0.27
28 0.23
29 0.19
30 0.13
31 0.12
32 0.11
33 0.08
34 0.07
35 0.07
36 0.08
37 0.07
38 0.07
39 0.05
40 0.06
41 0.07
42 0.08
43 0.09
44 0.09
45 0.08
46 0.09
47 0.1
48 0.13
49 0.18
50 0.18
51 0.16
52 0.17
53 0.18
54 0.17
55 0.16
56 0.16
57 0.15
58 0.15
59 0.16
60 0.17
61 0.2
62 0.22
63 0.26
64 0.26
65 0.25
66 0.27
67 0.29
68 0.27
69 0.25
70 0.25
71 0.21
72 0.2
73 0.16
74 0.18
75 0.16
76 0.15
77 0.14
78 0.12
79 0.13
80 0.12
81 0.12
82 0.07
83 0.07
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.07
93 0.08
94 0.09
95 0.08
96 0.08
97 0.08
98 0.1
99 0.12
100 0.13
101 0.16
102 0.21
103 0.22
104 0.25
105 0.29
106 0.28
107 0.3
108 0.38
109 0.39
110 0.38
111 0.4
112 0.36
113 0.33
114 0.3
115 0.27
116 0.19
117 0.14
118 0.12
119 0.1
120 0.11
121 0.1
122 0.1
123 0.11
124 0.11
125 0.12
126 0.15
127 0.17
128 0.24
129 0.29
130 0.34
131 0.36
132 0.38
133 0.39
134 0.4
135 0.4
136 0.4
137 0.41
138 0.45
139 0.52
140 0.58
141 0.66
142 0.7
143 0.75
144 0.76
145 0.81
146 0.81
147 0.82
148 0.82
149 0.83
150 0.83
151 0.83
152 0.82
153 0.72
154 0.66
155 0.62
156 0.57
157 0.5
158 0.48
159 0.49
160 0.51
161 0.5
162 0.48
163 0.44