Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QG68

Protein Details
Accession E3QG68    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
177-197LCRPCPKRLAFEKKIVKRYYCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 9, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MSPGGGEVIEEEARASVVKEVINQPGRNDIFVGDRPNQIALASGALIDGFNPGYGFNPGYGPMGYQLCTQCRRYWHTSFSETVCYRCRNAVGYRGGYFDDRSSISYGSGYGYGHGYDRGYGHGYGHGNGYGHGYGHGYGHGHGCCRCSYCERVRYSGDCGCRGNISICRDRCGRPALCRPCPKRLAFEKKIVKRYYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.1
5 0.11
6 0.15
7 0.18
8 0.26
9 0.34
10 0.34
11 0.33
12 0.4
13 0.4
14 0.36
15 0.34
16 0.26
17 0.24
18 0.26
19 0.3
20 0.24
21 0.25
22 0.25
23 0.25
24 0.24
25 0.19
26 0.17
27 0.12
28 0.1
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.05
40 0.06
41 0.07
42 0.08
43 0.08
44 0.08
45 0.09
46 0.1
47 0.1
48 0.09
49 0.1
50 0.11
51 0.11
52 0.14
53 0.15
54 0.18
55 0.22
56 0.24
57 0.24
58 0.29
59 0.34
60 0.38
61 0.4
62 0.41
63 0.42
64 0.43
65 0.42
66 0.39
67 0.4
68 0.33
69 0.32
70 0.3
71 0.27
72 0.25
73 0.24
74 0.23
75 0.19
76 0.21
77 0.25
78 0.25
79 0.26
80 0.25
81 0.25
82 0.25
83 0.22
84 0.2
85 0.14
86 0.11
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.07
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.08
106 0.1
107 0.1
108 0.1
109 0.13
110 0.14
111 0.14
112 0.14
113 0.13
114 0.12
115 0.12
116 0.13
117 0.09
118 0.09
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.07
125 0.08
126 0.11
127 0.11
128 0.13
129 0.14
130 0.15
131 0.16
132 0.18
133 0.2
134 0.21
135 0.29
136 0.35
137 0.42
138 0.44
139 0.47
140 0.49
141 0.49
142 0.5
143 0.48
144 0.43
145 0.39
146 0.37
147 0.34
148 0.3
149 0.29
150 0.28
151 0.29
152 0.31
153 0.37
154 0.36
155 0.4
156 0.42
157 0.43
158 0.44
159 0.46
160 0.45
161 0.45
162 0.54
163 0.6
164 0.66
165 0.74
166 0.74
167 0.76
168 0.78
169 0.73
170 0.72
171 0.73
172 0.74
173 0.71
174 0.75
175 0.76
176 0.78
177 0.84