Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3QVZ1

Protein Details
Accession E3QVZ1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
67-88IQRPERRPRVKGGKIRKRYVPTBasic
NLS Segment(s)
PositionSequence
69-84RPERRPRVKGGKIRKR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKQAPSTEPLRKKDCPTLHRQYPSPKRPERQPVRLKGLSSSPRGGTITNSQPRTEEVSVEEPRVTPIQRPERRPRVKGGKIRKRYVPTALCAFGIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.66
4 0.68
5 0.7
6 0.71
7 0.7
8 0.71
9 0.73
10 0.75
11 0.76
12 0.74
13 0.7
14 0.74
15 0.8
16 0.78
17 0.78
18 0.78
19 0.77
20 0.77
21 0.74
22 0.66
23 0.56
24 0.55
25 0.49
26 0.43
27 0.37
28 0.28
29 0.27
30 0.27
31 0.25
32 0.2
33 0.2
34 0.25
35 0.28
36 0.29
37 0.28
38 0.28
39 0.29
40 0.33
41 0.28
42 0.2
43 0.17
44 0.23
45 0.24
46 0.24
47 0.23
48 0.17
49 0.19
50 0.2
51 0.18
52 0.15
53 0.23
54 0.33
55 0.4
56 0.48
57 0.56
58 0.65
59 0.73
60 0.73
61 0.74
62 0.74
63 0.77
64 0.78
65 0.79
66 0.79
67 0.8
68 0.84
69 0.83
70 0.79
71 0.74
72 0.75
73 0.69
74 0.64
75 0.61
76 0.56