Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QQ84

Protein Details
Accession E3QQ84    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VAPSDTLRRRVIRRPRYRRDDMKIEIRDHydrophilic
164-188VGIWWFLRFRKRRRARQMQERGMPPHydrophilic
NLS Segment(s)
PositionSequence
173-177RKRRR
Subcellular Location(s) plas 10, nucl 8, mito 5, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVAPSDTLRRRVIRRPRYRRDDMKIEIRDDDHKDKEKDEDSSDDEDSPSPSKTKFSENAQPTRPPSQQPPPPAFNPADPTQAISSAGSSDQPQQTAGSSVTSQPAPAAFPQTTAASGAQSTNGISRGGNESGLGRDRSNEVGWTPTAIAFGTIAIAALCLVIGVGIWWFLRFRKRRRARQMQERGMPPDGLYWDPAMTFSPPSAPSRRAPSSVMAELMGQAYAAENGGYYGNPDRNSLTPQGYLDEKRVDPTRQLPILEPAPVAQPNVRNSIASWIRRHHPLKLNPMGGRSSVYSTRSVSPGSGPVNATAPPVPAVPAAYRSTDRVGSPGPGNPNNPQYASSSRYDTDSQSTRDDTNSILSLYQNRPPHEPDQREPWLMEPPAPLFAQRGVSMAPTEVTDRTDSTWRTWGAGASRPMNQAPAADAPRPGWIERCIKFGGLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.85
4 0.87
5 0.92
6 0.91
7 0.89
8 0.88
9 0.85
10 0.84
11 0.79
12 0.72
13 0.65
14 0.58
15 0.56
16 0.53
17 0.52
18 0.5
19 0.53
20 0.52
21 0.5
22 0.54
23 0.52
24 0.49
25 0.45
26 0.42
27 0.38
28 0.4
29 0.4
30 0.34
31 0.3
32 0.27
33 0.26
34 0.24
35 0.21
36 0.19
37 0.18
38 0.22
39 0.23
40 0.3
41 0.32
42 0.38
43 0.46
44 0.52
45 0.59
46 0.6
47 0.64
48 0.61
49 0.63
50 0.6
51 0.55
52 0.55
53 0.56
54 0.58
55 0.61
56 0.63
57 0.62
58 0.6
59 0.6
60 0.54
61 0.47
62 0.46
63 0.4
64 0.37
65 0.31
66 0.32
67 0.27
68 0.25
69 0.23
70 0.17
71 0.15
72 0.12
73 0.12
74 0.1
75 0.11
76 0.17
77 0.18
78 0.18
79 0.18
80 0.18
81 0.18
82 0.19
83 0.18
84 0.13
85 0.12
86 0.13
87 0.15
88 0.15
89 0.14
90 0.12
91 0.12
92 0.12
93 0.12
94 0.15
95 0.13
96 0.14
97 0.16
98 0.16
99 0.15
100 0.15
101 0.15
102 0.11
103 0.11
104 0.1
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.09
112 0.1
113 0.14
114 0.14
115 0.14
116 0.13
117 0.12
118 0.14
119 0.18
120 0.18
121 0.14
122 0.14
123 0.16
124 0.18
125 0.18
126 0.16
127 0.13
128 0.15
129 0.14
130 0.14
131 0.13
132 0.11
133 0.11
134 0.09
135 0.09
136 0.06
137 0.06
138 0.05
139 0.04
140 0.04
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.04
155 0.04
156 0.07
157 0.16
158 0.24
159 0.32
160 0.42
161 0.53
162 0.63
163 0.74
164 0.83
165 0.84
166 0.88
167 0.91
168 0.88
169 0.85
170 0.77
171 0.7
172 0.6
173 0.5
174 0.39
175 0.3
176 0.23
177 0.17
178 0.14
179 0.1
180 0.09
181 0.09
182 0.09
183 0.08
184 0.07
185 0.07
186 0.06
187 0.08
188 0.1
189 0.13
190 0.16
191 0.18
192 0.2
193 0.27
194 0.29
195 0.28
196 0.28
197 0.28
198 0.29
199 0.26
200 0.24
201 0.18
202 0.15
203 0.14
204 0.12
205 0.09
206 0.05
207 0.04
208 0.04
209 0.03
210 0.03
211 0.03
212 0.02
213 0.03
214 0.04
215 0.03
216 0.04
217 0.07
218 0.1
219 0.1
220 0.11
221 0.12
222 0.13
223 0.17
224 0.18
225 0.18
226 0.16
227 0.16
228 0.16
229 0.18
230 0.17
231 0.17
232 0.18
233 0.16
234 0.18
235 0.21
236 0.2
237 0.2
238 0.24
239 0.28
240 0.26
241 0.27
242 0.25
243 0.26
244 0.26
245 0.24
246 0.2
247 0.14
248 0.14
249 0.14
250 0.14
251 0.12
252 0.15
253 0.16
254 0.21
255 0.21
256 0.19
257 0.19
258 0.26
259 0.3
260 0.3
261 0.31
262 0.3
263 0.33
264 0.42
265 0.43
266 0.43
267 0.46
268 0.49
269 0.56
270 0.59
271 0.62
272 0.54
273 0.55
274 0.47
275 0.39
276 0.33
277 0.25
278 0.21
279 0.18
280 0.19
281 0.19
282 0.2
283 0.22
284 0.22
285 0.21
286 0.18
287 0.16
288 0.19
289 0.19
290 0.19
291 0.18
292 0.17
293 0.18
294 0.17
295 0.18
296 0.14
297 0.13
298 0.11
299 0.1
300 0.1
301 0.09
302 0.1
303 0.1
304 0.13
305 0.14
306 0.16
307 0.16
308 0.18
309 0.2
310 0.21
311 0.2
312 0.19
313 0.19
314 0.19
315 0.2
316 0.22
317 0.26
318 0.28
319 0.31
320 0.32
321 0.35
322 0.35
323 0.34
324 0.31
325 0.29
326 0.3
327 0.31
328 0.29
329 0.28
330 0.26
331 0.29
332 0.3
333 0.27
334 0.3
335 0.31
336 0.31
337 0.31
338 0.32
339 0.3
340 0.29
341 0.28
342 0.22
343 0.21
344 0.19
345 0.16
346 0.15
347 0.15
348 0.21
349 0.23
350 0.28
351 0.3
352 0.32
353 0.35
354 0.4
355 0.46
356 0.5
357 0.54
358 0.52
359 0.56
360 0.59
361 0.57
362 0.53
363 0.47
364 0.44
365 0.38
366 0.36
367 0.29
368 0.25
369 0.26
370 0.25
371 0.24
372 0.18
373 0.2
374 0.2
375 0.17
376 0.17
377 0.15
378 0.16
379 0.16
380 0.15
381 0.13
382 0.11
383 0.13
384 0.13
385 0.14
386 0.15
387 0.16
388 0.18
389 0.24
390 0.25
391 0.27
392 0.33
393 0.31
394 0.32
395 0.32
396 0.32
397 0.29
398 0.35
399 0.37
400 0.33
401 0.37
402 0.38
403 0.38
404 0.36
405 0.33
406 0.27
407 0.24
408 0.28
409 0.28
410 0.26
411 0.27
412 0.26
413 0.31
414 0.33
415 0.3
416 0.27
417 0.3
418 0.37
419 0.37
420 0.41
421 0.38