Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QA72

Protein Details
Accession E3QA72    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-35HGGILTTKQTKKKKERKKRISSFSNRSFHPHydrophilic
NLS Segment(s)
PositionSequence
15-24TKKKKERKKR
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MAHNGHGGILTTKQTKKKKERKKRISSFSNRSFHPTAFIIDCKGRPLSTARDDQDIDYRSRDMTGSDKQELLIYGLIQTGPEREHTRHFLDDSLPLFHHCHQRAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.53
3 0.63
4 0.71
5 0.78
6 0.83
7 0.89
8 0.91
9 0.95
10 0.95
11 0.94
12 0.94
13 0.93
14 0.91
15 0.89
16 0.83
17 0.72
18 0.68
19 0.6
20 0.49
21 0.42
22 0.33
23 0.26
24 0.23
25 0.23
26 0.18
27 0.18
28 0.18
29 0.17
30 0.17
31 0.14
32 0.13
33 0.16
34 0.19
35 0.21
36 0.27
37 0.26
38 0.28
39 0.28
40 0.28
41 0.3
42 0.26
43 0.23
44 0.19
45 0.18
46 0.15
47 0.15
48 0.15
49 0.1
50 0.13
51 0.17
52 0.2
53 0.21
54 0.21
55 0.21
56 0.22
57 0.21
58 0.18
59 0.13
60 0.09
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.12
69 0.15
70 0.17
71 0.23
72 0.28
73 0.32
74 0.34
75 0.34
76 0.32
77 0.3
78 0.33
79 0.29
80 0.27
81 0.24
82 0.23
83 0.24
84 0.27
85 0.35