Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QF61

Protein Details
Accession E3QF61    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
204-227HPDYRYTPRKPSEKRGGNRRSVSTHydrophilic
NLS Segment(s)
PositionSequence
212-220RKPSEKRGG
Subcellular Location(s) mito 10, cyto 6, nucl 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MALIFNPGKIVARNIDPTQVHPEILRIVMRILDLHLNAFESTIAVSGNDYTAFGEEGRLFMAMQMGRVLRKSVMWVKDGIDTNSNRWLLGPCDRFITGPHMIVSVNGIAVVVRRPPPQFLEEAAEATTHRVNTPEREIKVPRPPNAFILYRKDRQAHVKQMDPQIQNKGISQLLGKAWNAESHEVREKYRALAKAYKERHNKLHPDYRYTPRKPSEKRGGNRRSVSTQSARSVDSSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.34
4 0.36
5 0.4
6 0.38
7 0.34
8 0.28
9 0.28
10 0.23
11 0.24
12 0.22
13 0.14
14 0.14
15 0.14
16 0.14
17 0.13
18 0.13
19 0.14
20 0.13
21 0.13
22 0.13
23 0.14
24 0.13
25 0.13
26 0.11
27 0.08
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.11
49 0.09
50 0.09
51 0.11
52 0.12
53 0.12
54 0.13
55 0.14
56 0.11
57 0.11
58 0.16
59 0.21
60 0.23
61 0.23
62 0.24
63 0.24
64 0.29
65 0.31
66 0.27
67 0.25
68 0.23
69 0.24
70 0.29
71 0.28
72 0.22
73 0.21
74 0.2
75 0.18
76 0.25
77 0.25
78 0.2
79 0.22
80 0.22
81 0.22
82 0.22
83 0.25
84 0.18
85 0.17
86 0.16
87 0.14
88 0.14
89 0.14
90 0.13
91 0.07
92 0.06
93 0.05
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.08
100 0.11
101 0.11
102 0.13
103 0.15
104 0.16
105 0.17
106 0.16
107 0.18
108 0.15
109 0.15
110 0.14
111 0.12
112 0.11
113 0.11
114 0.11
115 0.08
116 0.07
117 0.09
118 0.1
119 0.13
120 0.2
121 0.25
122 0.25
123 0.29
124 0.32
125 0.36
126 0.44
127 0.48
128 0.45
129 0.44
130 0.44
131 0.43
132 0.45
133 0.42
134 0.36
135 0.39
136 0.4
137 0.38
138 0.41
139 0.4
140 0.38
141 0.44
142 0.49
143 0.5
144 0.47
145 0.49
146 0.52
147 0.56
148 0.61
149 0.55
150 0.5
151 0.46
152 0.45
153 0.41
154 0.35
155 0.31
156 0.23
157 0.21
158 0.19
159 0.16
160 0.15
161 0.17
162 0.16
163 0.15
164 0.16
165 0.17
166 0.19
167 0.2
168 0.2
169 0.22
170 0.31
171 0.3
172 0.31
173 0.33
174 0.32
175 0.32
176 0.37
177 0.36
178 0.33
179 0.38
180 0.43
181 0.49
182 0.55
183 0.6
184 0.63
185 0.65
186 0.69
187 0.71
188 0.73
189 0.72
190 0.76
191 0.7
192 0.7
193 0.71
194 0.72
195 0.73
196 0.69
197 0.7
198 0.68
199 0.75
200 0.73
201 0.77
202 0.78
203 0.78
204 0.83
205 0.84
206 0.85
207 0.85
208 0.84
209 0.79
210 0.75
211 0.7
212 0.68
213 0.65
214 0.61
215 0.58
216 0.54
217 0.49
218 0.45