Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q9W2

Protein Details
Accession E3Q9W2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
117-136SPTMARKKESRRQSKEQLTLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MAPKSSKAAHDDTKSESTAPKEKQTPGSGGHHSNGKLRRVASSTGSQLREVTNANAAADVQVAAKETAQNPAIQWSTFDRETLHAYRREHHLNTPTSFSCSYRQLVLSRPGGIGLHSPTMARKKESRRQSKEQLTLSVRKHFNGLGIQENDIIVDFIHKVRSHAITKSDRHKRSTSTPHDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.37
4 0.35
5 0.38
6 0.39
7 0.41
8 0.43
9 0.46
10 0.52
11 0.53
12 0.5
13 0.47
14 0.49
15 0.46
16 0.43
17 0.41
18 0.39
19 0.36
20 0.4
21 0.4
22 0.38
23 0.37
24 0.35
25 0.36
26 0.35
27 0.36
28 0.33
29 0.32
30 0.34
31 0.37
32 0.37
33 0.34
34 0.31
35 0.29
36 0.27
37 0.24
38 0.19
39 0.16
40 0.15
41 0.14
42 0.13
43 0.12
44 0.1
45 0.09
46 0.08
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.08
53 0.08
54 0.11
55 0.11
56 0.12
57 0.11
58 0.14
59 0.15
60 0.13
61 0.14
62 0.13
63 0.17
64 0.17
65 0.17
66 0.14
67 0.15
68 0.2
69 0.21
70 0.23
71 0.24
72 0.24
73 0.27
74 0.31
75 0.34
76 0.31
77 0.32
78 0.34
79 0.33
80 0.33
81 0.34
82 0.29
83 0.28
84 0.27
85 0.25
86 0.21
87 0.2
88 0.2
89 0.18
90 0.19
91 0.17
92 0.21
93 0.25
94 0.24
95 0.22
96 0.21
97 0.2
98 0.18
99 0.17
100 0.15
101 0.11
102 0.1
103 0.09
104 0.1
105 0.13
106 0.19
107 0.21
108 0.22
109 0.28
110 0.36
111 0.45
112 0.55
113 0.63
114 0.65
115 0.72
116 0.79
117 0.81
118 0.8
119 0.74
120 0.71
121 0.66
122 0.65
123 0.59
124 0.58
125 0.5
126 0.43
127 0.41
128 0.34
129 0.32
130 0.29
131 0.28
132 0.27
133 0.27
134 0.27
135 0.26
136 0.25
137 0.22
138 0.17
139 0.15
140 0.07
141 0.07
142 0.07
143 0.08
144 0.13
145 0.13
146 0.15
147 0.19
148 0.25
149 0.28
150 0.31
151 0.38
152 0.41
153 0.48
154 0.58
155 0.64
156 0.63
157 0.66
158 0.67
159 0.65
160 0.68
161 0.71