Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QGP7

Protein Details
Accession E3QGP7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-101PTKKVAKKAATPRKRKTPVKKTKNESEAEHydrophilic
NLS Segment(s)
PositionSequence
75-95KKVAKKAATPRKRKTPVKKTK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MAPATVWDDKARSDLLVAFLTVTKPSKEDWDRALAAVHEKGYTYTASAAIQHIQKLQRKEQTPGDSGEASATPTKKVAKKAATPRKRKTPVKKTKNESEAEDEEEQETPEQADDFLNVEDMAGDRFDHNDAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.13
6 0.13
7 0.13
8 0.14
9 0.15
10 0.12
11 0.13
12 0.14
13 0.22
14 0.25
15 0.28
16 0.3
17 0.34
18 0.34
19 0.34
20 0.34
21 0.25
22 0.24
23 0.22
24 0.19
25 0.12
26 0.12
27 0.12
28 0.12
29 0.11
30 0.09
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.11
37 0.12
38 0.12
39 0.15
40 0.19
41 0.23
42 0.27
43 0.32
44 0.36
45 0.37
46 0.4
47 0.44
48 0.43
49 0.4
50 0.38
51 0.35
52 0.28
53 0.26
54 0.22
55 0.15
56 0.12
57 0.12
58 0.11
59 0.09
60 0.1
61 0.15
62 0.18
63 0.23
64 0.28
65 0.32
66 0.39
67 0.5
68 0.59
69 0.65
70 0.71
71 0.74
72 0.78
73 0.82
74 0.84
75 0.84
76 0.85
77 0.86
78 0.87
79 0.9
80 0.86
81 0.87
82 0.85
83 0.76
84 0.69
85 0.65
86 0.57
87 0.52
88 0.45
89 0.36
90 0.3
91 0.27
92 0.23
93 0.16
94 0.14
95 0.09
96 0.09
97 0.08
98 0.08
99 0.08
100 0.08
101 0.09
102 0.09
103 0.09
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.09
113 0.11