Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QDU7

Protein Details
Accession E3QDU7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
3-24PQAAIKRTGKGKNQKVTKKFIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPQAAIKRTGKGKNQKVTKKFIINASQPASDKIFDVAAFEKFLQDKIKVEGRVGNLGDQVQISQQGEGKIEIIAHNELSGRYLKYLTKKFLKKQQLRDWLRVVSTSKGVYELKFFNVVNDEAEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.81
4 0.8
5 0.81
6 0.79
7 0.76
8 0.7
9 0.68
10 0.66
11 0.6
12 0.6
13 0.55
14 0.5
15 0.43
16 0.41
17 0.36
18 0.28
19 0.24
20 0.18
21 0.15
22 0.12
23 0.13
24 0.12
25 0.11
26 0.12
27 0.11
28 0.12
29 0.12
30 0.14
31 0.14
32 0.14
33 0.14
34 0.17
35 0.23
36 0.21
37 0.22
38 0.24
39 0.23
40 0.26
41 0.24
42 0.21
43 0.16
44 0.16
45 0.15
46 0.11
47 0.1
48 0.06
49 0.07
50 0.07
51 0.06
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.1
68 0.08
69 0.09
70 0.1
71 0.13
72 0.21
73 0.26
74 0.31
75 0.39
76 0.46
77 0.52
78 0.6
79 0.69
80 0.69
81 0.74
82 0.78
83 0.8
84 0.78
85 0.77
86 0.72
87 0.64
88 0.56
89 0.49
90 0.41
91 0.33
92 0.31
93 0.25
94 0.21
95 0.23
96 0.23
97 0.21
98 0.23
99 0.22
100 0.22
101 0.25
102 0.24
103 0.23
104 0.25
105 0.25
106 0.22
107 0.21
108 0.2