Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QGS2

Protein Details
Accession E3QGS2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
133-158HGRQGGRSSKDKKTRRPSPNAYERVPBasic
NLS Segment(s)
PositionSequence
100-116RRRIPSGDHKGKGKGTK
132-178RHGRQGGRSSKDKKTRRPSPNAYERVPKQPKPKDGAGEGSKGSGAKA
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MAAVQERSQQRLAPGLSQTQTETQSRTGTQAILRLRGAHAPSRQSVRWAEDVVDNEGLGRKSSKVCCIYHRPKAVDESSDESSSDSSSDSSDSEADDGGRRRIPSGDHKGKGKGTKRDHDHDCGDHGHDDPRHGRQGGRSSKDKKTRRPSPNAYERVPKQPKPKDGAGEGSKGSGAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.31
4 0.3
5 0.31
6 0.27
7 0.29
8 0.27
9 0.27
10 0.23
11 0.25
12 0.25
13 0.25
14 0.23
15 0.22
16 0.21
17 0.24
18 0.24
19 0.25
20 0.24
21 0.23
22 0.23
23 0.25
24 0.27
25 0.27
26 0.28
27 0.29
28 0.32
29 0.36
30 0.35
31 0.35
32 0.35
33 0.33
34 0.32
35 0.29
36 0.27
37 0.24
38 0.26
39 0.25
40 0.22
41 0.17
42 0.15
43 0.16
44 0.15
45 0.12
46 0.11
47 0.1
48 0.15
49 0.17
50 0.24
51 0.26
52 0.28
53 0.34
54 0.43
55 0.5
56 0.53
57 0.58
58 0.53
59 0.49
60 0.52
61 0.47
62 0.38
63 0.33
64 0.29
65 0.25
66 0.24
67 0.22
68 0.17
69 0.16
70 0.14
71 0.12
72 0.08
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.08
84 0.09
85 0.11
86 0.13
87 0.13
88 0.13
89 0.14
90 0.17
91 0.24
92 0.33
93 0.4
94 0.41
95 0.44
96 0.47
97 0.5
98 0.55
99 0.53
100 0.52
101 0.51
102 0.57
103 0.61
104 0.65
105 0.66
106 0.63
107 0.6
108 0.51
109 0.47
110 0.39
111 0.35
112 0.28
113 0.24
114 0.24
115 0.21
116 0.23
117 0.24
118 0.26
119 0.29
120 0.29
121 0.3
122 0.31
123 0.4
124 0.45
125 0.48
126 0.53
127 0.54
128 0.63
129 0.72
130 0.74
131 0.75
132 0.76
133 0.81
134 0.82
135 0.86
136 0.86
137 0.87
138 0.89
139 0.85
140 0.79
141 0.78
142 0.72
143 0.72
144 0.71
145 0.68
146 0.68
147 0.7
148 0.74
149 0.71
150 0.74
151 0.69
152 0.65
153 0.68
154 0.61
155 0.56
156 0.48
157 0.42
158 0.36