Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QAM5

Protein Details
Accession E3QAM5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
124-152GEVKRKKAASASKKSRRKYRQLDEEKAQSHydrophilic
NLS Segment(s)
PositionSequence
127-141KRKKAASASKKSRRK
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MRYRCVTARPALQKLKQQPHHLLLVAPFSVSPSAALKKHEMPPRPKPPPDSEIEESYLKGSGPGGQKINKTSSAVQLKHIPTGVVVKSQATRSRTQNRKIAREILAQKLDDLQNGDQSRSAIVGEVKRKKAASASKKSRRKYRQLDEEKAQSETAEAEVKEQHAEDQTNSAPSAHAEPATSTDASPHVQNLKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.73
4 0.73
5 0.72
6 0.68
7 0.67
8 0.58
9 0.5
10 0.41
11 0.37
12 0.29
13 0.21
14 0.17
15 0.14
16 0.13
17 0.11
18 0.11
19 0.11
20 0.15
21 0.17
22 0.2
23 0.23
24 0.28
25 0.36
26 0.42
27 0.47
28 0.51
29 0.6
30 0.68
31 0.72
32 0.71
33 0.69
34 0.69
35 0.66
36 0.62
37 0.6
38 0.53
39 0.48
40 0.46
41 0.41
42 0.34
43 0.3
44 0.25
45 0.17
46 0.13
47 0.1
48 0.12
49 0.14
50 0.18
51 0.2
52 0.23
53 0.26
54 0.28
55 0.31
56 0.28
57 0.27
58 0.25
59 0.3
60 0.34
61 0.33
62 0.32
63 0.37
64 0.36
65 0.34
66 0.33
67 0.25
68 0.17
69 0.2
70 0.18
71 0.13
72 0.12
73 0.12
74 0.13
75 0.16
76 0.2
77 0.19
78 0.23
79 0.29
80 0.39
81 0.45
82 0.49
83 0.53
84 0.54
85 0.56
86 0.55
87 0.53
88 0.46
89 0.46
90 0.44
91 0.43
92 0.4
93 0.34
94 0.31
95 0.29
96 0.26
97 0.2
98 0.18
99 0.13
100 0.17
101 0.18
102 0.18
103 0.15
104 0.15
105 0.15
106 0.13
107 0.12
108 0.07
109 0.09
110 0.14
111 0.22
112 0.28
113 0.3
114 0.32
115 0.33
116 0.32
117 0.36
118 0.42
119 0.44
120 0.48
121 0.57
122 0.65
123 0.73
124 0.8
125 0.84
126 0.83
127 0.84
128 0.83
129 0.83
130 0.84
131 0.85
132 0.86
133 0.81
134 0.79
135 0.7
136 0.61
137 0.51
138 0.39
139 0.3
140 0.23
141 0.18
142 0.14
143 0.12
144 0.12
145 0.14
146 0.15
147 0.15
148 0.15
149 0.15
150 0.15
151 0.17
152 0.16
153 0.19
154 0.2
155 0.2
156 0.21
157 0.19
158 0.16
159 0.15
160 0.19
161 0.16
162 0.15
163 0.14
164 0.15
165 0.18
166 0.21
167 0.2
168 0.16
169 0.16
170 0.18
171 0.19
172 0.19
173 0.2