Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q7H1

Protein Details
Accession E3Q7H1    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-33LFEDKGTKNKPKIQKRWIRFAGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, nucl 10.5, cyto 10, cyto_mito 7.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MAPKKSADWKALFEDKGTKNKPKIQKRWIRFAGGLKTLIIAKLNARVTALTLNPTNFSDYRKVKKALTVGREIDYADAWSVVFRICCDKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.49
4 0.5
5 0.51
6 0.51
7 0.59
8 0.68
9 0.7
10 0.74
11 0.75
12 0.8
13 0.78
14 0.82
15 0.78
16 0.72
17 0.65
18 0.61
19 0.55
20 0.47
21 0.42
22 0.31
23 0.28
24 0.23
25 0.2
26 0.14
27 0.09
28 0.07
29 0.13
30 0.13
31 0.12
32 0.12
33 0.12
34 0.12
35 0.14
36 0.13
37 0.1
38 0.1
39 0.11
40 0.12
41 0.13
42 0.15
43 0.14
44 0.16
45 0.22
46 0.27
47 0.33
48 0.38
49 0.41
50 0.38
51 0.43
52 0.48
53 0.48
54 0.47
55 0.47
56 0.44
57 0.43
58 0.42
59 0.37
60 0.3
61 0.23
62 0.19
63 0.12
64 0.1
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.09