Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3R123

Protein Details
Accession E3R123    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
132-157IQAHLDNQRQRKRKKVPLSPNSRFAAHydrophilic
NLS Segment(s)
PositionSequence
143-145KRK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences NYGVFVACYFAAREASITTKNTTSGWKSAGLWPVSSRRPLSNFLVSKASSTHQEDQQSSQPRSQQLDEAASIVPWSTPHRSADLRHQLHQLVQLGKDGLDTHTLRRPSRKMQKSWDNQASRLVLLKQQFQHIQAHLDNQRQRKRKKVPLSPNSRFAAVAHIQQARQSPDDSIDSLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.19
4 0.2
5 0.22
6 0.22
7 0.23
8 0.23
9 0.27
10 0.27
11 0.27
12 0.26
13 0.26
14 0.27
15 0.31
16 0.36
17 0.32
18 0.29
19 0.29
20 0.33
21 0.34
22 0.36
23 0.34
24 0.31
25 0.34
26 0.37
27 0.39
28 0.42
29 0.4
30 0.38
31 0.4
32 0.36
33 0.33
34 0.3
35 0.26
36 0.21
37 0.26
38 0.27
39 0.27
40 0.31
41 0.32
42 0.34
43 0.4
44 0.43
45 0.39
46 0.37
47 0.37
48 0.36
49 0.38
50 0.35
51 0.3
52 0.25
53 0.25
54 0.23
55 0.2
56 0.17
57 0.13
58 0.12
59 0.09
60 0.07
61 0.06
62 0.08
63 0.1
64 0.12
65 0.13
66 0.16
67 0.18
68 0.2
69 0.29
70 0.36
71 0.36
72 0.36
73 0.37
74 0.34
75 0.33
76 0.35
77 0.28
78 0.19
79 0.17
80 0.16
81 0.14
82 0.14
83 0.13
84 0.11
85 0.08
86 0.11
87 0.11
88 0.13
89 0.18
90 0.21
91 0.23
92 0.28
93 0.32
94 0.37
95 0.47
96 0.54
97 0.55
98 0.61
99 0.7
100 0.71
101 0.77
102 0.76
103 0.68
104 0.61
105 0.59
106 0.51
107 0.41
108 0.36
109 0.27
110 0.21
111 0.21
112 0.25
113 0.22
114 0.26
115 0.27
116 0.27
117 0.31
118 0.28
119 0.3
120 0.26
121 0.31
122 0.31
123 0.37
124 0.41
125 0.46
126 0.54
127 0.59
128 0.64
129 0.67
130 0.73
131 0.76
132 0.81
133 0.82
134 0.84
135 0.86
136 0.91
137 0.87
138 0.84
139 0.76
140 0.66
141 0.56
142 0.45
143 0.42
144 0.33
145 0.31
146 0.29
147 0.29
148 0.28
149 0.31
150 0.36
151 0.32
152 0.32
153 0.29
154 0.25
155 0.26
156 0.28