Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QR19

Protein Details
Accession E3QR19    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAPRRKKVKAKKIKTTGVKGKNTAHydrophilic
NLS Segment(s)
PositionSequence
3-20PRRKKVKAKKIKTTGVKG
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 5
Family & Domain DBs
Amino Acid Sequences MAPRRKKVKAKKIKTTGVKGKNTAERSDGSRDVARGDAGDDAEHVTEKEATMLLQLTQKVAGEDYFHRLPIEIRQMIYALAVVEEGKVRPVQVEARANKFHGSKTATKAFTSLLLTCRGFYEELLSRPDFYRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.86
5 0.82
6 0.75
7 0.73
8 0.71
9 0.65
10 0.57
11 0.49
12 0.42
13 0.4
14 0.42
15 0.36
16 0.31
17 0.3
18 0.28
19 0.26
20 0.24
21 0.2
22 0.14
23 0.14
24 0.11
25 0.09
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.05
38 0.06
39 0.06
40 0.06
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.08
51 0.13
52 0.13
53 0.13
54 0.13
55 0.13
56 0.13
57 0.15
58 0.2
59 0.16
60 0.16
61 0.16
62 0.16
63 0.16
64 0.15
65 0.12
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.11
79 0.17
80 0.25
81 0.28
82 0.34
83 0.36
84 0.37
85 0.39
86 0.37
87 0.32
88 0.29
89 0.31
90 0.31
91 0.36
92 0.43
93 0.41
94 0.4
95 0.39
96 0.34
97 0.32
98 0.29
99 0.25
100 0.19
101 0.23
102 0.23
103 0.22
104 0.23
105 0.22
106 0.19
107 0.17
108 0.21
109 0.21
110 0.23
111 0.28
112 0.28
113 0.28