Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3R0M8

Protein Details
Accession E3R0M8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-33LNKIPSYKKKAVNNSTRRRLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 11
Family & Domain DBs
Amino Acid Sequences MWTSDAPILVVVLNKIPSYKKKAVNNSTRRRLVIYNMKKLGKEKLLPEGAIDNKTMPRFISLCAACVYWNVHVLSHIHGYRHVHHFDNCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.16
4 0.22
5 0.3
6 0.37
7 0.43
8 0.5
9 0.61
10 0.69
11 0.75
12 0.8
13 0.81
14 0.83
15 0.78
16 0.71
17 0.63
18 0.55
19 0.52
20 0.52
21 0.5
22 0.49
23 0.51
24 0.51
25 0.49
26 0.49
27 0.47
28 0.4
29 0.35
30 0.28
31 0.3
32 0.29
33 0.28
34 0.27
35 0.26
36 0.23
37 0.2
38 0.19
39 0.13
40 0.14
41 0.15
42 0.15
43 0.12
44 0.13
45 0.12
46 0.13
47 0.2
48 0.18
49 0.19
50 0.19
51 0.19
52 0.16
53 0.17
54 0.18
55 0.11
56 0.15
57 0.14
58 0.13
59 0.14
60 0.15
61 0.17
62 0.22
63 0.22
64 0.19
65 0.23
66 0.26
67 0.31
68 0.37
69 0.37
70 0.35