Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q4P0

Protein Details
Accession E3Q4P0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
109-128NDECKGRRAGRPREEKTRLEBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
Amino Acid Sequences MSLGSTCQCPCDTCLGGSLGLCDATRPEFVCRCGFRNIVTKQWNEHGRVRRQDQCRCGEILCEKRARDHVKGCRLGGKKYVCLRPRTGDHVESHRLEFTDRKDFLAHFNDECKGRRAGRPREEKTRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.23
4 0.21
5 0.2
6 0.13
7 0.12
8 0.11
9 0.09
10 0.09
11 0.1
12 0.12
13 0.12
14 0.16
15 0.18
16 0.21
17 0.28
18 0.3
19 0.31
20 0.34
21 0.34
22 0.32
23 0.38
24 0.38
25 0.39
26 0.42
27 0.4
28 0.38
29 0.44
30 0.46
31 0.41
32 0.46
33 0.46
34 0.49
35 0.54
36 0.57
37 0.58
38 0.62
39 0.64
40 0.63
41 0.59
42 0.54
43 0.48
44 0.42
45 0.37
46 0.36
47 0.35
48 0.32
49 0.31
50 0.28
51 0.29
52 0.36
53 0.38
54 0.36
55 0.38
56 0.42
57 0.47
58 0.5
59 0.49
60 0.5
61 0.47
62 0.45
63 0.44
64 0.39
65 0.37
66 0.4
67 0.48
68 0.45
69 0.47
70 0.49
71 0.47
72 0.48
73 0.49
74 0.47
75 0.42
76 0.41
77 0.43
78 0.44
79 0.4
80 0.38
81 0.32
82 0.28
83 0.26
84 0.27
85 0.25
86 0.29
87 0.28
88 0.28
89 0.29
90 0.29
91 0.33
92 0.35
93 0.34
94 0.26
95 0.28
96 0.3
97 0.32
98 0.34
99 0.32
100 0.31
101 0.32
102 0.39
103 0.46
104 0.53
105 0.6
106 0.69
107 0.72
108 0.78