Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3Q220

Protein Details
Accession E3Q220    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-80EAREPHHKGKKTKEAKKGGKRDELSBasic
NLS Segment(s)
PositionSequence
60-76PHHKGKKTKEAKKGGKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRNRTRNSSVVNGSGDKNEFRSRTLTEARASRIRQPLTRSWDGKRDETAVEDAAIEAREPHHKGKKTKEAKKGGKRDELSARVFSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.26
4 0.26
5 0.28
6 0.25
7 0.25
8 0.27
9 0.26
10 0.3
11 0.34
12 0.33
13 0.31
14 0.33
15 0.36
16 0.39
17 0.39
18 0.39
19 0.42
20 0.42
21 0.41
22 0.42
23 0.44
24 0.46
25 0.51
26 0.47
27 0.42
28 0.46
29 0.46
30 0.43
31 0.37
32 0.31
33 0.25
34 0.24
35 0.23
36 0.16
37 0.13
38 0.11
39 0.1
40 0.08
41 0.08
42 0.06
43 0.05
44 0.06
45 0.11
46 0.14
47 0.21
48 0.29
49 0.36
50 0.43
51 0.53
52 0.63
53 0.68
54 0.75
55 0.78
56 0.81
57 0.84
58 0.88
59 0.89
60 0.86
61 0.86
62 0.79
63 0.76
64 0.74
65 0.7
66 0.63