Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QKT5

Protein Details
Accession E3QKT5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-128GQASKIEKASRQQRKQRKNRMKTLRGTAKVKHydrophilic
NLS Segment(s)
PositionSequence
103-135IEKASRQQRKQRKNRMKTLRGTAKVKGAKKKKE
Subcellular Location(s) mito 12, cyto 9.5, cyto_nucl 7.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADVDTPVTLRTRKFIRNPLLGRKQMVVDILHPGRANISKDELREKLGSLYKATKDQINVFGLRTQFGGGKTTGFALVYDSPEAMKKFEPHYRLVRVGQASKIEKASRQQRKQRKNRMKTLRGTAKVKGAKKKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.56
4 0.63
5 0.69
6 0.73
7 0.76
8 0.71
9 0.66
10 0.58
11 0.5
12 0.42
13 0.38
14 0.28
15 0.2
16 0.24
17 0.22
18 0.22
19 0.21
20 0.2
21 0.2
22 0.23
23 0.23
24 0.17
25 0.22
26 0.22
27 0.25
28 0.3
29 0.28
30 0.28
31 0.26
32 0.25
33 0.25
34 0.26
35 0.26
36 0.23
37 0.26
38 0.24
39 0.27
40 0.27
41 0.24
42 0.22
43 0.23
44 0.25
45 0.23
46 0.22
47 0.19
48 0.21
49 0.19
50 0.17
51 0.15
52 0.11
53 0.11
54 0.1
55 0.11
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.09
67 0.08
68 0.09
69 0.11
70 0.12
71 0.11
72 0.11
73 0.13
74 0.17
75 0.23
76 0.25
77 0.28
78 0.34
79 0.37
80 0.39
81 0.38
82 0.39
83 0.37
84 0.37
85 0.34
86 0.35
87 0.33
88 0.31
89 0.34
90 0.3
91 0.29
92 0.35
93 0.43
94 0.47
95 0.55
96 0.63
97 0.7
98 0.8
99 0.88
100 0.91
101 0.92
102 0.91
103 0.92
104 0.93
105 0.91
106 0.89
107 0.89
108 0.88
109 0.84
110 0.78
111 0.72
112 0.7
113 0.69
114 0.68
115 0.68