Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QGL3

Protein Details
Accession E3QGL3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-33LPTPLSLPRSRRRRRWVGVSVRWVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 6
Family & Domain DBs
Amino Acid Sequences MTGLMAIDLPTPLSLPRSRRRRRWVGVSVRWVSTRMAPSGMCGGGLHAKRPGTIGIWNSHAPIRVVRQFEGGWCVCRAIWIEHIKPPALFVSSIAAPRYGTWRCISLHADNDPLAVPAPSTAGTAAVNPTVDVPAFNPRARDGEVIGTDIGRCAFGPPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.24
3 0.34
4 0.45
5 0.54
6 0.64
7 0.73
8 0.79
9 0.83
10 0.85
11 0.85
12 0.85
13 0.84
14 0.83
15 0.76
16 0.68
17 0.6
18 0.51
19 0.42
20 0.37
21 0.31
22 0.23
23 0.22
24 0.19
25 0.2
26 0.22
27 0.2
28 0.15
29 0.12
30 0.12
31 0.16
32 0.17
33 0.17
34 0.17
35 0.17
36 0.17
37 0.18
38 0.18
39 0.13
40 0.16
41 0.17
42 0.16
43 0.19
44 0.2
45 0.2
46 0.2
47 0.19
48 0.16
49 0.16
50 0.18
51 0.19
52 0.21
53 0.2
54 0.22
55 0.21
56 0.2
57 0.24
58 0.19
59 0.16
60 0.14
61 0.14
62 0.12
63 0.12
64 0.13
65 0.1
66 0.15
67 0.18
68 0.19
69 0.22
70 0.23
71 0.23
72 0.21
73 0.2
74 0.15
75 0.12
76 0.11
77 0.08
78 0.09
79 0.1
80 0.11
81 0.11
82 0.1
83 0.09
84 0.1
85 0.15
86 0.13
87 0.14
88 0.14
89 0.17
90 0.17
91 0.21
92 0.24
93 0.22
94 0.26
95 0.25
96 0.26
97 0.23
98 0.23
99 0.19
100 0.16
101 0.13
102 0.09
103 0.07
104 0.05
105 0.07
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.08
112 0.09
113 0.09
114 0.09
115 0.08
116 0.09
117 0.09
118 0.08
119 0.08
120 0.09
121 0.16
122 0.2
123 0.21
124 0.22
125 0.24
126 0.27
127 0.29
128 0.3
129 0.23
130 0.25
131 0.25
132 0.25
133 0.24
134 0.21
135 0.18
136 0.17
137 0.16
138 0.1
139 0.09