Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QW16

Protein Details
Accession E3QW16   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-145EVSLKSLKKRGSRIWRRVTSRHNHydrophilic
NLS Segment(s)
PositionSequence
131-132KR
Subcellular Location(s) mito 13, cyto_nucl 8, nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MPSQILITEPHPTVAPNTYTYSGRGGAGNIFRAPVTTPAAGITTPFQPAAVHGPRRFYSGIGGAGNRHTAQEQAVRTFEEDFKRQEVRDRTATGHVGIGGAGNVMRKGSDASSVLSSESSTSEVSLKSLKKRGSRIWRRVTSRHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.23
5 0.24
6 0.25
7 0.26
8 0.26
9 0.23
10 0.21
11 0.19
12 0.16
13 0.17
14 0.18
15 0.19
16 0.17
17 0.16
18 0.15
19 0.15
20 0.15
21 0.14
22 0.15
23 0.13
24 0.13
25 0.13
26 0.14
27 0.13
28 0.13
29 0.12
30 0.09
31 0.1
32 0.1
33 0.09
34 0.08
35 0.1
36 0.16
37 0.2
38 0.25
39 0.26
40 0.3
41 0.3
42 0.34
43 0.33
44 0.26
45 0.22
46 0.18
47 0.19
48 0.16
49 0.16
50 0.13
51 0.13
52 0.14
53 0.12
54 0.1
55 0.08
56 0.08
57 0.08
58 0.12
59 0.13
60 0.13
61 0.13
62 0.13
63 0.14
64 0.15
65 0.17
66 0.16
67 0.17
68 0.17
69 0.2
70 0.22
71 0.22
72 0.28
73 0.3
74 0.32
75 0.34
76 0.34
77 0.33
78 0.35
79 0.35
80 0.28
81 0.24
82 0.18
83 0.14
84 0.12
85 0.09
86 0.06
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.07
96 0.1
97 0.1
98 0.12
99 0.14
100 0.14
101 0.14
102 0.13
103 0.13
104 0.1
105 0.1
106 0.1
107 0.09
108 0.09
109 0.11
110 0.11
111 0.12
112 0.18
113 0.21
114 0.27
115 0.34
116 0.4
117 0.45
118 0.53
119 0.62
120 0.67
121 0.74
122 0.77
123 0.81
124 0.84
125 0.85