Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QTM4

Protein Details
Accession E3QTM4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-107SQLDSKRFRRSKKSRRRFDIEVQHydrophilic
NLS Segment(s)
PositionSequence
90-101KRFRRSKKSRRR
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, mito 4
Family & Domain DBs
Amino Acid Sequences MKNDQRLSSGSSLQRPTFSAADLITSTSPSGSALLSPSLTTEPQSPTQNVCLPLSPLESPSLEKHGQRYEMFSFRVEGAYDAVLSQLDSKRFRRSKKSRRRFDIEVQKASCLNTIGCLVRVLVSQPLEATSSQDASIEVCTLIDDALNNLWIQLSYLARDITRFGQKHEIVSGPPIVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.38
4 0.32
5 0.28
6 0.23
7 0.18
8 0.19
9 0.17
10 0.17
11 0.13
12 0.13
13 0.12
14 0.1
15 0.1
16 0.08
17 0.08
18 0.07
19 0.07
20 0.08
21 0.09
22 0.09
23 0.09
24 0.1
25 0.11
26 0.11
27 0.12
28 0.14
29 0.16
30 0.2
31 0.24
32 0.24
33 0.25
34 0.29
35 0.31
36 0.3
37 0.28
38 0.24
39 0.22
40 0.21
41 0.22
42 0.18
43 0.15
44 0.14
45 0.14
46 0.15
47 0.15
48 0.2
49 0.19
50 0.2
51 0.23
52 0.25
53 0.28
54 0.26
55 0.29
56 0.27
57 0.28
58 0.28
59 0.25
60 0.22
61 0.19
62 0.19
63 0.15
64 0.11
65 0.09
66 0.08
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.08
74 0.11
75 0.14
76 0.16
77 0.26
78 0.31
79 0.36
80 0.45
81 0.54
82 0.62
83 0.71
84 0.8
85 0.8
86 0.83
87 0.86
88 0.81
89 0.8
90 0.8
91 0.76
92 0.72
93 0.63
94 0.55
95 0.49
96 0.43
97 0.34
98 0.23
99 0.16
100 0.1
101 0.11
102 0.11
103 0.11
104 0.1
105 0.09
106 0.09
107 0.09
108 0.09
109 0.1
110 0.1
111 0.1
112 0.1
113 0.1
114 0.11
115 0.11
116 0.12
117 0.11
118 0.11
119 0.11
120 0.11
121 0.1
122 0.1
123 0.1
124 0.08
125 0.07
126 0.06
127 0.06
128 0.06
129 0.06
130 0.05
131 0.05
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.09
141 0.1
142 0.1
143 0.13
144 0.14
145 0.14
146 0.15
147 0.16
148 0.19
149 0.28
150 0.27
151 0.29
152 0.38
153 0.39
154 0.42
155 0.43
156 0.39
157 0.31
158 0.34