Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QP78

Protein Details
Accession E3QP78    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-66TLFPVPKEKEKEKKKKRFNILALLHydrophilic
NLS Segment(s)
PositionSequence
49-59KEKEKEKKKKR
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MHVYVPRSYNGMISYKKKLFIEYLLLQIQGSRQSFSQQGPSITLFPVPKEKEKEKKKKRFNILALLAAPLSHCLFCPSPPPNTMLCDAQPFMPCPTANRRARLPNHLSKAHFFFHRAKVAKSVMPNKDEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.44
4 0.43
5 0.42
6 0.38
7 0.35
8 0.38
9 0.31
10 0.33
11 0.29
12 0.29
13 0.26
14 0.24
15 0.22
16 0.2
17 0.18
18 0.15
19 0.14
20 0.16
21 0.19
22 0.2
23 0.25
24 0.22
25 0.22
26 0.23
27 0.25
28 0.23
29 0.21
30 0.22
31 0.16
32 0.15
33 0.22
34 0.22
35 0.26
36 0.31
37 0.38
38 0.45
39 0.55
40 0.65
41 0.69
42 0.77
43 0.82
44 0.85
45 0.88
46 0.88
47 0.81
48 0.79
49 0.71
50 0.63
51 0.52
52 0.43
53 0.33
54 0.23
55 0.18
56 0.1
57 0.08
58 0.05
59 0.05
60 0.08
61 0.08
62 0.09
63 0.15
64 0.16
65 0.19
66 0.2
67 0.23
68 0.21
69 0.23
70 0.25
71 0.21
72 0.19
73 0.19
74 0.19
75 0.19
76 0.19
77 0.18
78 0.18
79 0.19
80 0.18
81 0.19
82 0.27
83 0.34
84 0.38
85 0.4
86 0.44
87 0.5
88 0.55
89 0.61
90 0.62
91 0.61
92 0.63
93 0.65
94 0.62
95 0.58
96 0.57
97 0.51
98 0.45
99 0.4
100 0.4
101 0.41
102 0.48
103 0.46
104 0.43
105 0.46
106 0.48
107 0.48
108 0.5
109 0.53
110 0.5