Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QD85

Protein Details
Accession E3QD85   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
8-27DSTQRFLRKIKKPPRTIEAFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MTLIMTLDSTQRFLRKIKKPPRTIEAFIKAARILTFPVSVSPSPATYILQTDKSRPRFPRRFPGRSADQGPDIEHNFPNDIPLPSTGCAMEIPDDMSDSNVHNLLIPGYDDYVPWRKTGST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.52
4 0.61
5 0.68
6 0.74
7 0.79
8 0.81
9 0.79
10 0.75
11 0.73
12 0.69
13 0.63
14 0.54
15 0.48
16 0.4
17 0.33
18 0.28
19 0.2
20 0.14
21 0.12
22 0.12
23 0.11
24 0.12
25 0.14
26 0.13
27 0.15
28 0.14
29 0.13
30 0.14
31 0.14
32 0.13
33 0.1
34 0.13
35 0.13
36 0.17
37 0.18
38 0.22
39 0.29
40 0.34
41 0.4
42 0.44
43 0.53
44 0.56
45 0.6
46 0.66
47 0.67
48 0.67
49 0.64
50 0.64
51 0.59
52 0.55
53 0.54
54 0.44
55 0.37
56 0.33
57 0.31
58 0.27
59 0.23
60 0.2
61 0.17
62 0.16
63 0.15
64 0.14
65 0.15
66 0.14
67 0.13
68 0.12
69 0.13
70 0.14
71 0.14
72 0.15
73 0.13
74 0.11
75 0.11
76 0.1
77 0.1
78 0.08
79 0.09
80 0.08
81 0.09
82 0.09
83 0.1
84 0.1
85 0.1
86 0.11
87 0.11
88 0.11
89 0.11
90 0.11
91 0.1
92 0.1
93 0.1
94 0.09
95 0.11
96 0.11
97 0.1
98 0.16
99 0.24
100 0.24
101 0.24