FuNGI

E3QVP5

Protein Details

Accession

E3QVP5

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
436-460	VPATKPTPMKKAKAKAKVAKTVYRK	Hydrophilic

NLS Segment(s)

Position	Sequence
442-455	TPMKKAKAKAKVAK

Subcellular Location(s)

nucl 10, mito 7, cyto_nucl 7, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR018108 Mitochondrial_sb/sol_carrier IPR023395 Mt_carrier_dom_sf
Gene Ontology	GO:0005743 C:mitochondrial inner membrane
Pfam	View protein in Pfam PF00153 Mito_carr

Amino Acid Sequences

MASHREGGVNPLRPYYKPPTIGEPSDPTSASSAPNPFARHAGNATSERYASKARDIFSDIDYKDYISEPSPSVVQTVKDLVDELLWKYASVLTAQPFEVAKTVLQVRSHDDVTMGAPAASAAATPLATPVSERLQSQYGSAVFSEGDSDSDLDEPAYFTSNAPVTPTPSYRHRQSSPSPPHTPAPKQPVPPYHLNIRRSDSLMEVIGQLWQKEGAWGVWKGSNATFLYSILSSLLENWSRSALSALFNVPDLGVKEDIDRLIDIASPYPWASLCAAAAAAVATGLILAPLDLVRTRLIVTPTSKQPRRTLSTLRALPSYVCPSLLVVPTILHSLIHPILTLSTPLVLRTRFLIDSRVSPTTFSIAKFCASSAALFVKLPLETVLRRGQVAVLSTPSHVRALSGKDQKLETNVPPGRYHGVVGTMFYIMNEEGSRAVPATKPTPMKKAKAKAKVAKTVYRKGQGLEGLWRGWKVSWWGLVGLWTAGVIGNSAEGEF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.47
2	0.48
3	0.48
4	0.47
5	0.49
6	0.52
7	0.56
8	0.59
9	0.57
10	0.54
11	0.49
12	0.47
13	0.44
14	0.36
15	0.32
16	0.29
17	0.26
18	0.25
19	0.24
20	0.25
21	0.29
22	0.3
23	0.29
24	0.32
25	0.32
26	0.3
27	0.29
28	0.29
29	0.31
30	0.31
31	0.33
32	0.31
33	0.3
34	0.27
35	0.27
36	0.29
37	0.25
38	0.3
39	0.31
40	0.3
41	0.33
42	0.36
43	0.35
44	0.33
45	0.39
46	0.31
47	0.3
48	0.29
49	0.26
50	0.23
51	0.22
52	0.21
53	0.14
54	0.17
55	0.15
56	0.17
57	0.17
58	0.16
59	0.17
60	0.17
61	0.17
62	0.16
63	0.18
64	0.16
65	0.16
66	0.16
67	0.14
68	0.14
69	0.15
70	0.13
71	0.14
72	0.14
73	0.13
74	0.13
75	0.15
76	0.13
77	0.13
78	0.15
79	0.14
80	0.16
81	0.16
82	0.17
83	0.16
84	0.16
85	0.16
86	0.13
87	0.11
88	0.13
89	0.17
90	0.18
91	0.2
92	0.21
93	0.25
94	0.28
95	0.29
96	0.25
97	0.21
98	0.19
99	0.18
100	0.18
101	0.13
102	0.08
103	0.08
104	0.07
105	0.07
106	0.06
107	0.05
108	0.03
109	0.04
110	0.04
111	0.04
112	0.05
113	0.05
114	0.05
115	0.06
116	0.08
117	0.11
118	0.13
119	0.13
120	0.16
121	0.18
122	0.19
123	0.19
124	0.2
125	0.17
126	0.16
127	0.16
128	0.13
129	0.1
130	0.1
131	0.11
132	0.07
133	0.07
134	0.07
135	0.07
136	0.07
137	0.08
138	0.08
139	0.07
140	0.06
141	0.06
142	0.06
143	0.08
144	0.08
145	0.08
146	0.1
147	0.11
148	0.11
149	0.13
150	0.13
151	0.14
152	0.17
153	0.19
154	0.2
155	0.26
156	0.32
157	0.35
158	0.41
159	0.41
160	0.45
161	0.49
162	0.56
163	0.59
164	0.62
165	0.61
166	0.56
167	0.58
168	0.58
169	0.57
170	0.53
171	0.52
172	0.49
173	0.49
174	0.52
175	0.53
176	0.52
177	0.53
178	0.49
179	0.49
180	0.51
181	0.5
182	0.48
183	0.47
184	0.43
185	0.39
186	0.36
187	0.28
188	0.22
189	0.19
190	0.16
191	0.12
192	0.1
193	0.11
194	0.11
195	0.09
196	0.08
197	0.08
198	0.07
199	0.07
200	0.08
201	0.06
202	0.09
203	0.09
204	0.1
205	0.12
206	0.12
207	0.13
208	0.13
209	0.16
210	0.13
211	0.14
212	0.13
213	0.11
214	0.12
215	0.1
216	0.1
217	0.07
218	0.07
219	0.05
220	0.06
221	0.08
222	0.08
223	0.08
224	0.09
225	0.09
226	0.09
227	0.09
228	0.09
229	0.08
230	0.07
231	0.08
232	0.08
233	0.08
234	0.08
235	0.08
236	0.07
237	0.07
238	0.06
239	0.07
240	0.07
241	0.07
242	0.07
243	0.08
244	0.08
245	0.08
246	0.07
247	0.06
248	0.06
249	0.06
250	0.06
251	0.06
252	0.06
253	0.06
254	0.06
255	0.07
256	0.06
257	0.06
258	0.07
259	0.07
260	0.06
261	0.06
262	0.06
263	0.05
264	0.05
265	0.04
266	0.03
267	0.02
268	0.02
269	0.02
270	0.02
271	0.02
272	0.02
273	0.02
274	0.02
275	0.02
276	0.02
277	0.03
278	0.03
279	0.04
280	0.05
281	0.06
282	0.07
283	0.09
284	0.11
285	0.14
286	0.17
287	0.2
288	0.29
289	0.38
290	0.41
291	0.43
292	0.47
293	0.52
294	0.55
295	0.55
296	0.54
297	0.51
298	0.56
299	0.56
300	0.52
301	0.45
302	0.4
303	0.35
304	0.32
305	0.29
306	0.2
307	0.16
308	0.14
309	0.15
310	0.17
311	0.17
312	0.14
313	0.09
314	0.09
315	0.1
316	0.11
317	0.1
318	0.07
319	0.06
320	0.09
321	0.09
322	0.09
323	0.09
324	0.08
325	0.09
326	0.09
327	0.09
328	0.06
329	0.07
330	0.07
331	0.09
332	0.11
333	0.11
334	0.11
335	0.13
336	0.16
337	0.15
338	0.16
339	0.2
340	0.18
341	0.22
342	0.26
343	0.27
344	0.24
345	0.23
346	0.23
347	0.22
348	0.23
349	0.2
350	0.18
351	0.16
352	0.17
353	0.16
354	0.16
355	0.14
356	0.13
357	0.12
358	0.12
359	0.13
360	0.13
361	0.12
362	0.13
363	0.12
364	0.11
365	0.11
366	0.1
367	0.11
368	0.11
369	0.15
370	0.2
371	0.2
372	0.2
373	0.2
374	0.2
375	0.19
376	0.2
377	0.18
378	0.15
379	0.15
380	0.16
381	0.17
382	0.17
383	0.16
384	0.14
385	0.14
386	0.15
387	0.21
388	0.29
389	0.36
390	0.37
391	0.39
392	0.41
393	0.41
394	0.42
395	0.41
396	0.34
397	0.36
398	0.38
399	0.37
400	0.37
401	0.38
402	0.37
403	0.32
404	0.31
405	0.21
406	0.22
407	0.19
408	0.19
409	0.17
410	0.15
411	0.14
412	0.13
413	0.13
414	0.09
415	0.1
416	0.09
417	0.09
418	0.09
419	0.1
420	0.11
421	0.09
422	0.11
423	0.12
424	0.16
425	0.19
426	0.25
427	0.33
428	0.36
429	0.46
430	0.52
431	0.59
432	0.64
433	0.71
434	0.74
435	0.76
436	0.83
437	0.82
438	0.84
439	0.85
440	0.82
441	0.81
442	0.79
443	0.78
444	0.76
445	0.74
446	0.67
447	0.59
448	0.58
449	0.52
450	0.47
451	0.45
452	0.4
453	0.34
454	0.34
455	0.33
456	0.29
457	0.25
458	0.25
459	0.24
460	0.25
461	0.27
462	0.26
463	0.27
464	0.26
465	0.27
466	0.25
467	0.19
468	0.14
469	0.1
470	0.09
471	0.08
472	0.08
473	0.06
474	0.05
475	0.06

E3QVP5

3D AlphaFold-predicted Structure Viewer