Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QER0

Protein Details
Accession E3QER0   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-68DAVWCEEEKKRKRRKYAKRRNSRQLSNSRSNHydrophilic
NLS Segment(s)
PositionSequence
46-59KKRKRRKYAKRRNS
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MESFWSKTNKPNPSLGFLSALAPPPSSPPEKSRPLFVDAVWCEEEKKRKRRKYAKRRNSRQLSNSRSNVIDKKLCLGISPGTEAPLSIISEAWGFLPSYLTPVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.48
3 0.41
4 0.34
5 0.32
6 0.25
7 0.25
8 0.19
9 0.17
10 0.15
11 0.15
12 0.19
13 0.2
14 0.21
15 0.24
16 0.31
17 0.39
18 0.39
19 0.43
20 0.41
21 0.43
22 0.41
23 0.35
24 0.37
25 0.29
26 0.31
27 0.26
28 0.23
29 0.2
30 0.23
31 0.32
32 0.32
33 0.42
34 0.49
35 0.55
36 0.66
37 0.76
38 0.84
39 0.86
40 0.89
41 0.9
42 0.91
43 0.93
44 0.93
45 0.91
46 0.87
47 0.85
48 0.83
49 0.8
50 0.77
51 0.69
52 0.61
53 0.54
54 0.5
55 0.45
56 0.4
57 0.35
58 0.27
59 0.28
60 0.28
61 0.26
62 0.23
63 0.21
64 0.19
65 0.17
66 0.2
67 0.17
68 0.16
69 0.16
70 0.15
71 0.14
72 0.13
73 0.12
74 0.09
75 0.09
76 0.08
77 0.09
78 0.09
79 0.08
80 0.08
81 0.07
82 0.07
83 0.09
84 0.09