Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3Q9K0

Protein Details
Accession E3Q9K0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
112-133EDEGTPKKKRARKAKGKAAAAABasic
NLS Segment(s)
PositionSequence
83-95PRPKKAATPRKKK
117-130PKKKRARKAKGKAA
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MPPKAALPVPGLTATEAEIKLAFAVLKFMRRPNTTPVYDAIAVEAGSASGDSVRHGVRKAADKHGWFSQAPAEDPASAPAATPRPKKAATPRKKKIAEVDDEDEATAAGQGEDEGTPKKKRARKAKGKAAAAATEKDASEGEEDDKNGAASAPTPVSEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.13
5 0.13
6 0.12
7 0.11
8 0.12
9 0.1
10 0.06
11 0.11
12 0.12
13 0.17
14 0.19
15 0.24
16 0.31
17 0.34
18 0.38
19 0.41
20 0.47
21 0.44
22 0.43
23 0.4
24 0.38
25 0.35
26 0.31
27 0.24
28 0.17
29 0.15
30 0.13
31 0.1
32 0.05
33 0.04
34 0.04
35 0.03
36 0.03
37 0.04
38 0.04
39 0.06
40 0.08
41 0.09
42 0.1
43 0.12
44 0.15
45 0.23
46 0.27
47 0.33
48 0.37
49 0.36
50 0.39
51 0.39
52 0.39
53 0.3
54 0.27
55 0.23
56 0.19
57 0.19
58 0.17
59 0.15
60 0.12
61 0.12
62 0.12
63 0.1
64 0.09
65 0.08
66 0.09
67 0.12
68 0.17
69 0.19
70 0.2
71 0.23
72 0.24
73 0.28
74 0.37
75 0.44
76 0.5
77 0.59
78 0.64
79 0.7
80 0.72
81 0.7
82 0.68
83 0.64
84 0.59
85 0.54
86 0.5
87 0.41
88 0.39
89 0.36
90 0.27
91 0.2
92 0.14
93 0.08
94 0.05
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.06
101 0.09
102 0.13
103 0.15
104 0.21
105 0.29
106 0.34
107 0.43
108 0.54
109 0.62
110 0.69
111 0.78
112 0.84
113 0.85
114 0.83
115 0.79
116 0.71
117 0.65
118 0.56
119 0.47
120 0.38
121 0.31
122 0.27
123 0.23
124 0.19
125 0.15
126 0.13
127 0.13
128 0.14
129 0.14
130 0.15
131 0.15
132 0.15
133 0.14
134 0.13
135 0.12
136 0.1
137 0.08
138 0.11
139 0.11
140 0.11