Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QCD7

Protein Details
Accession E3QCD7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
257-279VQEGGKRKKSKAAPRDRGPFWRGBasic
NLS Segment(s)
PositionSequence
261-276GKRKKSKAAPRDRGPF
Subcellular Location(s) cyto 12, nucl 6, cyto_pero 6, extr 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045030  LYSM1-4  
IPR018392  LysM_dom  
IPR036779  LysM_dom_sf  
Pfam View protein in Pfam  
PF01476  LysM  
CDD cd00118  LysM  
Amino Acid Sequences MKTDRGSAAAVDGEACCTCAKLLASVPRHSAATEKPLPDDRRPECCSRVICGNCIHNNPRFASYCPYCQTSSAPSVLPPNLRDPPSYSSFPPTHHLSSGAPAAPPPPYAPSAADAPLDEKSGGCAPSSSSSTATPPEDTLHFLDHEHDTIASLSLRYGVPAAVLRRANNIASDHLLQGRRTILIPGEYYAAGVSLSPRPVEGEEEELRKSRIRRFMTGCKVSDYDVAVLYLEQVGYDLAAAMEAYLDDEAWERNNPVQEGGKRKKSKAAPRDRGPFWRGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.1
4 0.09
5 0.09
6 0.11
7 0.12
8 0.13
9 0.19
10 0.27
11 0.32
12 0.35
13 0.39
14 0.37
15 0.37
16 0.34
17 0.33
18 0.27
19 0.31
20 0.33
21 0.31
22 0.33
23 0.42
24 0.47
25 0.49
26 0.55
27 0.51
28 0.54
29 0.58
30 0.59
31 0.54
32 0.55
33 0.51
34 0.46
35 0.5
36 0.43
37 0.42
38 0.42
39 0.46
40 0.44
41 0.48
42 0.49
43 0.45
44 0.46
45 0.45
46 0.44
47 0.39
48 0.36
49 0.38
50 0.37
51 0.38
52 0.37
53 0.39
54 0.35
55 0.34
56 0.34
57 0.3
58 0.3
59 0.25
60 0.22
61 0.2
62 0.23
63 0.25
64 0.25
65 0.22
66 0.25
67 0.28
68 0.29
69 0.29
70 0.29
71 0.32
72 0.34
73 0.35
74 0.3
75 0.31
76 0.32
77 0.32
78 0.33
79 0.33
80 0.29
81 0.27
82 0.28
83 0.22
84 0.23
85 0.23
86 0.19
87 0.14
88 0.13
89 0.13
90 0.12
91 0.12
92 0.1
93 0.1
94 0.1
95 0.12
96 0.12
97 0.13
98 0.14
99 0.14
100 0.14
101 0.11
102 0.12
103 0.11
104 0.11
105 0.1
106 0.08
107 0.08
108 0.1
109 0.1
110 0.09
111 0.08
112 0.09
113 0.11
114 0.13
115 0.12
116 0.11
117 0.12
118 0.13
119 0.15
120 0.15
121 0.13
122 0.12
123 0.12
124 0.11
125 0.13
126 0.13
127 0.12
128 0.11
129 0.11
130 0.12
131 0.11
132 0.11
133 0.09
134 0.08
135 0.07
136 0.07
137 0.08
138 0.06
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.08
148 0.09
149 0.12
150 0.14
151 0.14
152 0.17
153 0.18
154 0.18
155 0.17
156 0.18
157 0.14
158 0.16
159 0.16
160 0.14
161 0.17
162 0.19
163 0.17
164 0.17
165 0.16
166 0.15
167 0.14
168 0.14
169 0.11
170 0.12
171 0.12
172 0.11
173 0.12
174 0.11
175 0.11
176 0.09
177 0.08
178 0.06
179 0.06
180 0.07
181 0.08
182 0.08
183 0.08
184 0.09
185 0.1
186 0.11
187 0.13
188 0.13
189 0.17
190 0.19
191 0.21
192 0.23
193 0.23
194 0.24
195 0.25
196 0.28
197 0.29
198 0.35
199 0.38
200 0.44
201 0.5
202 0.59
203 0.65
204 0.68
205 0.62
206 0.57
207 0.53
208 0.47
209 0.42
210 0.34
211 0.25
212 0.18
213 0.17
214 0.13
215 0.12
216 0.11
217 0.09
218 0.07
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.04
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.04
232 0.04
233 0.04
234 0.04
235 0.06
236 0.07
237 0.09
238 0.11
239 0.12
240 0.15
241 0.2
242 0.2
243 0.23
244 0.3
245 0.35
246 0.44
247 0.52
248 0.59
249 0.61
250 0.63
251 0.68
252 0.71
253 0.75
254 0.75
255 0.77
256 0.78
257 0.81
258 0.87
259 0.84
260 0.83
261 0.77